KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337297Help
Entry
4337297           CDS       T01015                                 

Definition
(RefSeq) GTP cyclohydrolase 1
  KO
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4337297
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     4337297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 403 aa AA seqDB search
MQKVRDIVPVALFPEVGVDKRTGSAGGTGGQVVVRDIDLFSYCESCLLPFSIQFHVGYVP
SGGRVVGLSKLSRVADVFAKRLQNPQRLASEVCGALHASIQPAGVAVALQCWHIPLPENL
KCKTLQGWISTSHSSRSGVFEGESSSFWNDFSALLKLRGIDMERDSHSASIAWCPLRSHD
VPVCNGHCKKATTNGAISPKSVPAPSNMVSAVSSMLLSLGEDPFRKELVGTPQRYVQWLM
KFRACNLDVKLNGFTLNNLSVYQSPAGDAADHRAIHSELHLPFCAQCEHHLLPFYGVVHI
GYLDGGDGEVIDRSHFQALVHFYGCKLQVQERMTRQIAEAVYSVSHCGAIVVVEANHICM
ISRGIEKIRSSTATIAVLGQFLTDPSAKARFLQNVVDTTGLAV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagtaagggacattgtgcctgtggctctctttcctgaggttggtgttgacaag
aggactggttctgctggaggaactggagggcaagttgttgttcgtgatattgatcttttc
tcatactgtgagtcatgcttacttccattcagcatacaattccatgttggctatgtgccc
tctggtggaagggttgttgggttaagcaagctttcgagagtagctgatgtcttcgccaag
aggttgcagaatcctcaaagactggctagtgaagtttgtggtgcattgcatgctagcata
caacctgctggtgtggctgttgctctgcaatgttggcacatacctttgccagaaaacttg
aaatgcaagactttgcaaggttggattagcacttcacattcatctcgctctggagttttt
gagggtgagagcagctctttttggaatgacttctcagcccttcttaagcttaggggcata
gacatggagagggacagccattctgcctccatagcttggtgccctttaaggtctcatgat
gtcccagtctgcaatgggcactgcaagaaggctacaaccaacggtgcaatttcacccaaa
tcagtaccagctccctctaatatggtttctgctgttagctcaatgctcttatcccttgga
gaggatcccttcaggaaagaacttgtaggtactcctcagcgttacgtgcaatggctgatg
aagttcagagcatgtaacctagatgtgaagctgaatggctttacactcaataatttgagt
gtataccagagtccagctggagatgctgctgaccatcgagcaatccattctgagctgcat
ttgccattttgtgcgcagtgcgagcaccatcttctgccgttctatggagtagtgcatatt
ggctaccttgacggcggagatggtgaagtgattgatcgatctcattttcaggccttggtt
catttttatggatgcaagcttcaggttcaagagagaatgacaaggcagatagctgaagca
gtttattctgtttcgcattgtggggccatagttgttgtagaagctaaccacatttgcatg
atatcaaggggaatagagaaaatcaggagtagcactgcaacgattgcagttctgggtcag
tttttgacggacccttctgccaaggcacgctttctgcagaacgtagtagatacaactggt
ttggcagtatga

DBGET integrated database retrieval system