KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337328Help
Entry
4337328           CDS       T01015                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase isozyme L3
  KO
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4337328
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   4337328
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    4337328
  UBL-specific proteases (ULPs)
   4337328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 241 aa AA seqDB search
MAAVPSAAAPPVPVSPGERWPPLESSPDVFNQLMWSLGVPEDVAEFHDVYSLDADALEMV
PQPVLAVVFCFPDPTQDASNPSQHLLITGEKETLFFIKQIESLGNACGTIALLHAVGNAY
SEISLSENSFLDMFIKSTSGMTSYERAVFLEKDDDMARAHLSAASAGDTKLSDDVEEHYI
CFVECDGTLYELDGMKPGPINHGPSSSKSLLQDAVNIIKATMHNIPNSVNFNVIVLSRKA
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggtgccctccgccgccgcgccgccggttccggtctcccccggcgagagatgg
ccgccgctcgagtcgagccccgacgtattcaaccagctcatgtggtcgctgggtgtcccg
gaggacgtggcggagttccacgacgtgtacagcctcgacgccgatgcgctggagatggtg
ccccagcctgtgctcgccgtcgtcttctgcttccccgatccaacccaggatgcaagtaat
ccttcacagcatcttttaattactggagagaaggaaactttgtttttcataaaacaaatt
gaatcactaggaaatgcttgtggaactattgcgctacttcatgctgttggaaatgcatat
tcagaaatcagtttgtcggagaattctttcttggacatgtttatcaaatcaacatctggc
atgacttcatacgagcgtgctgtgtttcttgagaaggatgatgacatggcaagagctcac
ttatcggctgccagtgccggtgacacaaagctatctgatgacgttgaagagcattatata
tgttttgtcgaatgtgatggaacactctatgagcttgatggtatgaagcctggaccaata
aatcatggcccatcatcctctaaaagcttactgcaggatgctgtgaatatcattaaggcc
accatgcacaacattcccaactcggtgaacttcaacgtaatagtgctatcaagaaaagca
gagtaa

DBGET integrated database retrieval system