KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337426Help
Entry
4337426           CDS       T01015                                 

Definition
Os04g0680000
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:osa03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:osa03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 444 aa AA seqDB search
MPQVMVVARNFMDMVAALPAAKLDMLYDSAFICEAVLRSLPPLAKKYALQMLYVSAPVAA
AAMEEWVLDEYAAKHRVAIDRLLQLRVFVEVRDRRKEVSYKMNQKFQGNMQKYLVDGGSL
PREPIPSSVTARLPTLAELESFALEQWEVRMTKAYVCISYCLNATNVHSPSKGTHSFLYG
KIVLLAAIDQLISSRERDKFQLIHDENFSARSSEFKLMETNAQLWYIMREYISSAEERGV
DPTELISFLLELSFHTLGEAYSLNTLTDVQRNAIRDLAELGLVKLQQGFVVVETNFRMYA
YSTSRLHCEILRLFSRVEYQLPNLIVGSITKESLYGAFENGITAEQIISFLQQNAHPRVA
DKIPAVPENVTDQIRLWETDRNRVDMTLSHLYEDFPSKDMFDQCCDYARDHGCLLWEDAK
KMRLIVRVEFHSEMHDYSVQERSD
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggtaatggtggtcgcgcggaacttcatggacatggtggccgcgctgccggcc
gccaagctcgacatgctctacgactccgccttcatctgcgaggccgtgctcaggtcgctc
ccgccgctcgcgaagaagtacgcgctgcagatgctgtacgtgtcggcgccggtggccgct
gcggccatggaggagtgggtgctcgacgagtacgccgccaagcacagggtcgccatcgat
aggctgctccaactgagggtatttgtcgaggtgcgcgatcgaagaaaggaggtgagctac
aagatgaaccagaagttccagggcaacatgcaaaagtatttggttgatggtggaagttta
ccaagggaacctataccatcgagtgtcactgcaaggttgcctacattggcagaattagag
tcttttgctcttgagcagtgggaggtcaggatgacaaaagcttatgtttgcatatcgtac
tgtttgaatgctaccaatgttcactcccctagtaaaggaactcattcttttctctatggg
aaaatagtgcttcttgctgcaattgatcaactcatctcaagtcgagagagggacaagttt
cagctcatccatgatgagaacttttcagcgaggtcttctgagttcaagctgatggagaca
aatgctcaactttggtacatcatgagagaatacatctcatcagcagaggaacgtggtgtg
gaccccacggagttgatatcatttctattggaacttagttttcatacattaggagaggct
tatagcttgaatactctgaccgatgtccaaagaaatgctattagggatctggcggagttg
ggactggtcaaacttcagcagggttttgtagttgtggagacaaatttccggatgtatgcg
tactcaacttccagattacattgtgaaattctgcgccttttttcaagagtggagtatcaa
cttccaaacctaattgtgggatctattacaaaagaaagtctttatggtgcttttgagaat
gggattaccgctgaacagataatttcattccttcagcagaatgctcatcctcgtgttgct
gacaagatacctgcagtcccagagaacgttacagatcagattaggttgtgggaaacggat
cgtaacagggttgatatgaccctatcgcatttatatgaagattttccaagcaaggatatg
tttgatcaatgctgtgattatgcaagagatcatgggtgcttgctgtgggaggatgcgaag
aagatgagattaattgtacgagtggagttccattcagaaatgcatgattactccgtgcaa
gagaggagcgattag

DBGET integrated database retrieval system