KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337426Help
Entry
4337426           CDS       T01015                                 

Definition
(RefSeq) general transcription factor IIH subunit 4
  KO
K03144  
transcription initiation factor TFIIH subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    4337426
  Replication and repair
   03420 Nucleotide excision repair
    4337426
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4337426
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4337426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 451 aa AA seqDB search
MPQVMVVARNFMDMVAALPAAKLDMLYDSAFICEAVLRSLPPLAKKYALQMLYVSAPVAA
AAMEEWVLDEYAAKHRVAIDRLLQLRVFVEVRDRRKEVSYKMNQKFQGNMQKYLVDGGSL
PREPIPSSVTARLPTLAELESFALEQWECFLLQLINSSQVERGTSFSSSMMRTFQRGLLS
SRDGEAPRLTENGFQFLLMETNAQLWYIMREYISSAEERGVDPTELISFLLELSFHTLGE
AYSLNTLTDVQRNAIRDLAELGLVKLQQGRKDSWFIPTKLATNLSASLSDSSSNKEGFVV
VETNFRMYAYSTSRLHCEILRLFSRVEYQLPNLIVGSITKESLYGAFENGITAEQIISFL
QQNAHPRVADKIPAVPENVTDQIRLWETDRNRVDMTLSHLYEDFPSKDMFDQCCDYARDH
GCLLWEDAKKMRLIVRVEFHSEMREFLRRLR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggtaatggtggtcgcgcggaacttcatggacatggtggccgcgctgccggcc
gccaagctcgacatgctctacgactccgccttcatctgcgaggccgtgctcaggtcgctc
ccgccgctcgcgaagaagtacgcgctgcagatgctgtacgtgtcggcgccggtggccgct
gcggccatggaggagtgggtgctcgacgagtacgccgccaagcacagggtcgccatcgat
aggctgctccaactgagggtatttgtcgaggtgcgcgatcgaagaaaggaggtgagctac
aagatgaaccagaagttccagggcaacatgcaaaagtatttggttgatggtggaagttta
ccaagggaacctataccatcgagtgtcactgcaaggttgcctacattggcagaattagag
tcttttgctcttgagcagtgggagtgcttcttgctgcaattgatcaactcatctcaagtc
gagagagggacaagtttcagctcatccatgatgagaacttttcagcgaggtcttctgagt
tcaagagatggtgaagctccaagattaactgagaacgggttccagtttctgctgatggag
acaaatgctcaactttggtacatcatgagagaatacatctcatcagcagaggaacgtggt
gtggaccccacggagttgatatcatttctattggaacttagttttcatacattaggagag
gcttatagcttgaatactctgaccgatgtccaaagaaatgctattagggatctggcggag
ttgggactggtcaaacttcagcagggtcgaaaggacagctggttcatacctacaaaactg
gctacaaatctctcagcaagcttgtcagattcatcgtctaacaaagagggttttgtagtt
gtggagacaaatttccggatgtatgcgtactcaacttccagattacattgtgaaattctg
cgccttttttcaagagtggagtatcaacttccaaacctaattgtgggatctattacaaaa
gaaagtctttatggtgcttttgagaatgggattaccgctgaacagataatttcattcctt
cagcagaatgctcatcctcgtgttgctgacaagatacctgcagtcccagagaacgttaca
gatcagattaggttgtgggaaacggatcgtaacagggttgatatgaccctatcgcattta
tatgaagattttccaagcaaggatatgtttgatcaatgctgtgattatgcaagagatcat
gggtgcttgctgtgggaggatgcgaagaagatgagattaattgtacgagtggagttccat
tcagaaatgcgtgagttcctccggaggctaagataa

DBGET integrated database retrieval system