KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337620Help
Entry
4337620           CDS       T01015                                 

Definition
Os05g0115900
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:osa00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:osa00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:osa00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:osa00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:osa00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 541 aa AA seqDB search
MPPKLLTYLILALLAASAAAARRHPSPASSAAAGEPVYLWPLPRNFTSGSRTLLVDPDLA
LDGQGPGGAAAAVAEAFERYRSLVFSPWAHAARNASGGYDVGKLTVVVASADEKLELGVD
ESYTIYVAAAGGVNSIVGGATIEANTIYGAIRGLETFSQLCVFNYDTKNVEVRHAPWYIE
DEPRFAFRGLLLDTSRHFLPVDVIKQVIDSMSFSKLNVLHWHIIDEQSFPLEVPSYPKLW
KGSYSKLERYTVEDARDIVSYARKRGIHVMAEIDVPGHAESWGKGYPKLWPSPKCREPLD
VTSNFTFEVISGILSDMRKIFPFGLFHLGGDEVYTGCWNATPHVKQWLHERNMTTKDAYK
YFVLKAQEIAINLNWIPVNWEETFNSFKENLNPLTVVHNWLGPGVCPKVVEKGFRCIMSN
QGVWYLDHLDVPWQDFYTSEPLAGINNTAQQKLVLGGEVCMWGETADTSDVQQTIWPRAA
AAAERMWSQLEAISAQDLETTVLARLHYFRCLLNHRGIAAAPVTNSYARRPPIGPGSCFI
Q
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaaactcctcacttatctcatcctagccctcctcgccgcctccgccgccgca
gcgcggcgccacccgtctccggcgagctcagccgccgccggggagcccgtctacctatgg
ccgctgccgaggaacttcacctcgggttcccggaccctgctggtcgaccctgacctcgcg
ctcgacggccagggccccggcggcgccgccgcggcggtggccgaggcgttcgagaggtac
agatcgctcgtcttctctccatgggcgcacgccgcgcgcaacgcctcgggtgggtacgac
gtcgggaagctcaccgtcgtcgtcgcctccgccgatgagaagctggagcttggagtggac
gagagctacacgatctatgtcgcggcggcgggcggcgtcaattcgatcgtgggtggagca
accatagaggctaacaccatatatggagctattcgtggattagagacattcagtcaattg
tgtgttttcaactacgataccaaaaatgtcgaagtgcgtcatgccccatggtacattgaa
gacgaaccacgctttgcttttcgtgggttgctccttgacacatcaaggcatttcctccca
gtagatgtgattaaacaagtgattgactccatgtcattttctaagctgaatgttcttcat
tggcatatcatcgacgagcaatcttttccattagaagtaccatcatatccaaaactatgg
aagggttcatattcaaaattggagcgctacactgtggaagatgcacgtgatattgtcagc
tatgctaggaaaagaggtatccatgtcatggctgaaattgacgtgcctggccatgcagaa
tcatggggaaagggatatccaaagctctggccttctcctaagtgcagagaaccgttagat
gttactagcaatttcacatttgaagttatttctggaattttgtctgatatgagaaaaatc
tttccatttgggctcttccacttgggtggtgatgaagtatatacaggttgctggaatgca
acaccccatgtgaaacagtggcttcatgaacgcaacatgactacaaaagatgcttacaaa
tacttcgtcctgaaggctcaagagatagcaattaaccttaattggattccagtaaattgg
gaagaaaccttcaactcattcaaagaaaatctcaatcctctaaccgtggtgcataactgg
ctgggtcctggagtctgccctaaagttgttgaaaagggtttcagatgtataatgagtaac
caaggtgtatggtaccttgatcatcttgatgttccctggcaagatttctacactagtgag
ccactcgctggaattaataacacagcacagcaaaagcttgtacttggtggagaggtttgc
atgtggggtgagacagcagacacctctgatgttcagcaaacgatatggccacgagcagct
gcagcagcagagcgtatgtggagtcagttagaggccatatctgcccaagacctggaaaca
accgtcttggctcggttacactatttcagatgcctgctgaatcaccgtggaatcgctgca
gctccagtcacaaactcttatgctcggcgtcccccaattggtcctggttcatgcttcatt
cagtaa

DBGET integrated database retrieval system