KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337686Help
Entry
4337686           CDS       T01015                                 

Definition
(RefSeq) phosphoinositide phospholipase C 2
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4337686
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    4337686
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    4337686
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     4337686
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4337686
 Endocytosis
  Macropinocytosis
   Phospholipase C
    4337686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 4337686
NCBI-ProteinID: XP_015640813
UniProt: Q75IL8
Position
5
AA seq 598 aa AA seqDB search
MTTYRVCCFLRRFRAASNEPSEELGDVFQAYADGGGGVMGEEALRRFLREVQGEAAGGGD
DELEATAREVMAFAAEQRLLRKGGAAAAGGGLTVEGFHRWLCSDANAALDPQKRVYQDMG
LPLSHYFIYTGHNSYLTGNQLSSGCSEVPIVKALHDGVRVIELDLWPNAAKDAVEVLHGR
TLTSPVGLMKCLEAIREYAFVASPYPVILTLEDHLTPDLQSKVAKMIKETFGDMLYVSET
ENMAEFPSPDELKGKIIVSTKPPKEYLQTKNDADADEAGVWGEEITDDKVAATAMTTEEK
CAAAEEAVAAAAVDEEMQEAETDKKTQHGVDNEYRRLIAIPLTRRKHDMDQDLKVDPDMV
TRLSLGEKAYEKAIVTHGAHIIRFTQRKLLRIFPRSTRITSSNYNPLMGWRYGVQMVAAN
MQGHGRKLWLTQGMFRANGGCGYVKKPDILMNNDPDKLFDPTSKLPVKTRLKVTVYMGDG
WRFDFRKTHFDKCSPPDFYARVGIAGVEADTRMEQTKVKMDTWIPAWDHEFEFPLSVPEL
ALLRVEVHESDNHQKDDFGGQTCLPVWELRRGIRSVRLCDHRGEPLRSVKLLMRFDFT
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgtacagggtgtgctgcttcctgcggcggttcagggcggcgtcgaacgagccg
tcggaggagctcggcgacgtgttccaggcgtacgccgacggcggcggcggcgtgatgggg
gaggaggcgctgaggcggttcctccgggaggtgcagggggaggccgccggcggcggcgac
gacgagctggaggcgacggcgagggaggtgatggccttcgcggcggagcagaggctgctc
aggaagggcggcgccgctgccgccggcggcgggctcaccgtcgagggcttccaccgctgg
ctgtgcagcgacgccaacgctgcactggatcctcagaaacgggtatatcaagacatggga
ttgcctctgtcacactacttcatctacacggggcacaactcatacctgacggggaaccag
ctgagcagcgggtgcagcgaggtgcccatcgtgaaggccctccacgacggcgtccgtgtc
atcgagctcgacctctggcccaacgctgccaaggacgccgtcgaggtcctccacggcagg
acgctgacatcgccagtgggtctgatgaaatgccttgaggccatcagggagtacgcgttc
gtcgcctccccttaccccgtcatcctcaccctcgaagatcacctcactcccgacctccaa
tccaaagtcgccaagatgatcaaggagacgttcggtgacatgctctacgtctctgaaact
gagaacatggcggaattcccttcgccggacgagctcaaggggaagatcatcgtgtcgacg
aagccgcccaaggagtacctccagaccaagaacgacgccgacgccgacgaggccggcgtc
tggggcgaggagatcaccgacgacaaggtggcggcgacggcgatgacgacagaagagaaa
tgcgcggcggcggaggaagcagtcgccgccgccgccgtcgacgaggagatgcaggaggcc
gagacggacaagaagacgcagcacggggtggacaacgagtacaggcgcctcatcgccatc
cctctgacaagaagaaagcacgacatggatcaggacctcaaggtcgatcccgacatggtg
acgcgcctcagcctcggggagaaggcctacgagaaggccattgtcacccatggagctcac
attatcaggtttacgcagaggaaattgctgaggatattccctcggtcgacgcgcattacg
tcttcgaattataatcctttgatgggttggaggtatggagttcagatggttgcagcaaac
atgcagggccatggaagaaagctgtggctgactcaggggatgttccgagcaaacggcggt
tgcggttacgtcaaaaagcctgatattctgatgaacaacgatccagataaactgtttgat
cctacatccaaactaccagtaaagacaagactaaaggtgacggtgtacatgggagacgga
tggcgattcgacttccgcaagacacatttcgacaaatgctcacccccagacttctatgca
agggtgggtatagccggagtagaagcagacacgaggatggagcagacgaaggtgaagatg
gacacgtggattccggcatgggatcacgagttcgagttcccgttgagcgtgccggagctg
gcgctgctccgggtggaggtgcacgagtccgacaaccaccagaaggacgacttcggcggg
cagacctgcctgccggtgtgggagctccggcgaggcatccgctccgtcaggctctgcgac
caccgcggcgagcccctccgctccgtcaagctcctcatgcgcttcgacttcacctga

DBGET integrated database retrieval system