KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338174Help
Entry
4338174           CDS       T01015                                 

Gene name
OsTOR, TOR
Definition
(RefSeq) serine/threonine-protein kinase TOR
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4338174 (OsTOR)
Protein kinases [BR:osa01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   4338174 (OsTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 2465 aa AA seqDB search
MKPSPHFPEIGKKPKDLIAKEHGFNIAAYISSGADVIAAALRKHVEEEARDLSGEAFLRF
MEQLYEQICSLLQSNDVAENLLALRAIDALIDMPFGEGASKVSKFANFLRTVFEVKRDPE
VLVPASAVLGHLAKAGGAMTADEVERQIKTALGWLGGDRVEYRRFASVLILKEMAENAST
VFNVHVPEFVDAIWVALRDPKQAVRERAVEALRACLHVIEKRETRWRVQWYYRMCEAAQV
GLGKNASVHSIHGSLLAVGELLRNTGEFMMSRYREVADIVLNYLRHRDQLVRRSITSLLP
RIAHFLRDRFVTNYLKICMDHILFVLRTPDERASGFVALGEMAGALGAELVPYLPLITSH
LHDAIAPRRGRPSLEAISCVGSFAKAMGPAMEPHIRGGLLDAMFSAGLSDKLVEALESIS
TSIPSLLPTIQERLLDCISQALPKSSVRPGAAVGRGSRSSSLQQFVDSGGPVLVQLALGT
LANFNFKGHELLEFARESVILYLEDEDCSTRKAAATCCCKLVAHSLSASSSSQFSSNRPN
RMGGAKRRRLVEEIVEKLLMAAVADADVGVRSSVFKALYRNPSFDDFLAQADIMTSIFVA
LNDEEYHVRELAISVAGRLSEKNPAYVLPALRRYLIQLLTYLDQSMDSKCREESARLLGC
LIRSCARLILPYIAPIHKALVARLREGTGPNANNALAAGVLATVGELAKVGGFAMRQYLP
ELMPLVVDALLDGGAVSKREVAVATLGQVIQSTGYVISPYNEYPPLLGLLLKLLNGELEW
STRLEVLKVLGIMGALDPHAHKRNQHKLPGQHREVLRPTMETAQHIVSMEELPTDFWPSF
SASEDYYSTVAISSLMRILHDPSLSSYHQMVVGSLIFIFKSMGLGCVPYLPKVLPELFRA
VRMCEDGGLKEFITWKLGTLVSIVRQHIRKYLQEILSLVSELWTSSFSLPAPNRTVQGPQ
ASPVLHLVEQLCLALNDEFRMYILHILPSCIQVLGDAERCNDYYYVPDILHTLEVFGGNL
DEHMHLVAPVLVRLFKVELVDIRRRAIVTLTKLIPTVQVGTHVSVLVHHLKLVLDGNNDD
LRKDAAEALCCLAHALGEDFTIFVSSIHKLLVKHHMRYRKWDEIENRLLRREPLISENLS
VQKYTQCPPEVISDPLDDFGGVPSEEADETQRQPRSHQVNDVRLRSAGEASQRSTREDWA
EWMRHFSIALLKESPSPALRTCARLAQLQPSVGRELFAAGFASCWAQMNETSQEQLVRSL
KTAFSSQNIPPEILATLLNLAEFMEHDEKPLPIDTRLLGALAEKCRAFAKALHYKEMEFE
AVCSKKMGANPVTVVESLIHINNQLHQHEAAIGILTYSQQHLEVQLKESWYEKLHRWDEA
LKAYKAKSSQASGPLQNLDATLGRMRCLAALARWEDLSALCREQWTGSEPSARLEMAPMA
ANAAWHMGEWDHMAEYVSRLDDGDENKLRILGNTTASGDGSSNGAFFRAVLSVRCKKYEE
ARVYVERARRCLATELAALVLESYERAYNNMVRVQQLSELEEVIDYCTLPMESPIADSRR
ELIRNMWNERIKGTKRNVEVWQALLAVRELVLPPNEDRDTWIKFAKLCWKSGRISQAKST
LVKLLQFDPESSPELTLYHGHPQVVLAYLKYQYAVGDELKRRDAFCRLQDLSVQLATATN
SYSGTLASQVATSNAGVPLIARVYLTLASWKRALSPGLDDDSIQEILVSYKNATLNAKDW
GKAWHLWALFNTEVMSRYTLRGRPDIAGKYVVAAVTGYFYSIACASTTKGVDDSLQDILR
LLTLWFNHGATSEVQMALQKGFSLVNIEMWLVVLPQIIARIHSNNKIVRELIQSLLVRIG
KDHPQALMYPLLVACKSISILRQRAAQEVVDKIRQHSGGLVDQAQLVSKELIRVAILWHE
MWHEALEEASRMYFGEHNIEGMLAVLEPLHAMLERGPETIKENTFIQAYGHELLEAHECC
LKYRATGEDAELTKAWDLYYHVFRRIDKQLPSLTTLDLHSVSPELLECRKLELAVPGTYS
ADAPLVTIEYFVPQLIVITSKQRPRKLTIHGSDGNDYAFLLKGHEDLRQDERVMQLFGLV
NTLLENSRKTSEKDLSIQRYAVIPLSPNSGLIGWVPNCDTLHALIREYRDARKIFLNQEH
RCMLSFAPDYDHLPLIAKVEVFQHALENSEGNDLAKVLWLKSRTSEVWLERRTNYTRSLA
VMSMVGYLLGLGDRHPSNLMLDRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVK
AMEVSGIEGTFRTTCENVMQVLRTNKDSVMAMMEAFVHDPLINWRLFNFNEVPQVTNYGN
AHSHTVVNSEEAANRELMQPPRGARERELLQAVNQLGDANEVLNERAVAVMARMSHKLTG
RDFSSGSSLSGAGSSTQHGNEHLASGDTREVEPGLSVKVQVQRLILQATSHENLCQNYVG
WCPFW
NT seq 7398 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctcgccgcacttcccggagatcgggaagaagcccaaagatttgatagccaag
gaacacgggttcaacatcgcggcgtacatctcgtcgggagcggatgttattgctgccgcc
ctaagaaaacatgttgaggaagaagctcgagatctgagtggcgaggcttttctgagattt
atggaacagctctatgaacagatatgtagtctcttgcaaagcaacgatgttgctgaaaat
ttacttgctcttcgtgctattgatgctttgatcgatatgcctttcggagaaggtgcttca
aaggtttctaagttcgcaaatttcttgcgaactgtttttgaagtcaagcgtgatcctgaa
gttctagttccagcaagcgcagtgcttggccatttagcaaaagctggcggtgcaatgact
gcagatgaggtggagcgtcagattaaaacggctttaggatggcttggtggggatcgagtg
gagtatcgccgctttgcttctgtccttattctcaaagagatggctgaaaatgcatcaaca
gttttcaatgttcatgttcctgaatttgttgatgctatatgggtagcactgagagatccc
aaacaggctgttcgtgagcgagcagtggaagcattgcgtgcctgtctccatgttattgaa
aaacgtgagacacgttggcgtgtgcaatggtattaccgcatgtgtgaagcagcacaggtt
ggtcttggaaaaaatgcctctgttcatagcattcatggctcgctattggctgttggagaa
ttattgaggaatactggggagtttatgatgtctaggtacagagaagtggctgatatagtc
ctcaattacctaagacaccgggatcagcttgttcgtcgtagtataacttcgcttcttcct
cgaattgctcacttcctgcgtgacagatttgtgaccaactacttaaagatttgcatggat
catatcttgtttgttttacgtacaccggatgagcgtgctagtggctttgttgctcttgga
gagatggctggcgctcttggtgctgaacttgtgccctatttgcctttaattacctcacac
ttgcatgatgcgattgctcctcgtaggggacgcccatctcttgaggcaatttcttgtgtg
ggaagtttcgcaaaagctatgggtcctgcaatggaacctcatatacgtggtggactacta
gatgcgatgttttctgctggtctttctgataaacttgtagaggcacttgagtctataagt
accagcatcccatctctactgccaacaatacaggaacgattgttggattgtatatctcaa
gcactgccaaagtcatccgtgaggcctggtgctgctgttggccgaggaagcagatcaagc
agtttgcagcagtttgtggattctggtggtccagttcttgtgcagcttgcattggggact
ctagcaaatttcaactttaagggtcatgagcttctggaatttgctagagagagtgtcatc
ctttatctggaagatgaggattgcagtacccgtaaagctgctgcaacatgctgctgcaaa
ctagttgcgcattccctttcagcttcgtctagctcacagtttagctcaaaccggccaaat
cgtatgggaggagctaagcgtcgccgccttgtagaagagattgtggagaaacttcttatg
gctgcagttgctgatgctgatgttggtgttagaagttctgtattcaaggctctatatcgg
aatccatcttttgatgattttttggcccaagctgacatcatgacttcaatttttgttgcc
ttaaatgatgaggagtaccatgtcagagaattggcaatatcagttgcaggtagattgtct
gaaaaaaatcctgcttatgtactgcctgcccttcgccgttatcttatacagttgctcaca
tatcttgaccaaagtatggatagcaagtgtagagaggaaagtgctagattgttgggttgc
ttaattaggagttgtgcacgactcattcttccttatattgctccaattcacaaggcacta
gtggctaggttacgtgaaggaacaggaccgaatgctaataatgcgcttgcagcaggagtg
cttgctactgttggagagttggccaaagtgggtggttttgcaatgaggcaatatcttcct
gagctaatgcctctagttgtggatgctcttttggatggaggtgctgttagtaaaagggaa
gtggcagtagcaacccttggacaagttatccaaagcacaggctatgttatctctccttat
aatgagtatcctccattgcttggtttactcttgaaattgctgaatggcgaattggaatgg
tctactagactggaagtgctgaaggttttaggtattatgggtgcattggacccgcacgca
cataagcgtaatcaacataagctacctggtcaacatagggaggtcttgcggccaacgatg
gaaacagcacaacatattgtttccatggaagaactgccaactgatttctggccatccttt
tcagcatctgaggactattattcaacagttgcaattagttctctcatgcggattcttcat
gatccttccctttcaagttatcatcagatggtggttggctctcttatatttatttttaag
tcgatgggacttggctgtgttccatatttaccaaaggttctccctgagctattccgcgct
gttcgcatgtgtgaggatggtggtttgaaagagttcattacctggaagcttgggacattg
gtatctattgttcgacagcacattcggaaatatttacaagaaatactctctcttgtgtct
gaattgtggacttcctcattcagcttacctgcaccaaatcggactgtccaaggtccacaa
gcttctccggttcttcaccttgttgaacaactatgcttggcactgaatgacgaattcaga
atgtatatacttcacatattgccaagttgtattcaagtcctgggtgatgctgaacgctgc
aatgactattactatgttcctgacatattgcacaccctagaggtgtttggaggaaatttg
gatgagcacatgcacttggttgctccagtacttgttcggttatttaaagtggagctagtt
gatatcagacgccgtgccattgtcactttgactaaactcatacctacggtgcaggttggt
actcatgtttcggttttggtgcatcatctaaagctagttttggatggaaacaatgatgat
ctacggaaagatgcagcagaggcgctttgttgtcttgcacatgctcttggagaagatttt
acaatattcgtgtcatcaatacacaagcttcttgtgaagcaccatatgcggtatagaaaa
tgggatgagattgaaaatcgattactaaggcgagagccactcatctctgagaacttatca
gtacaaaagtacacacaatgcccgcctgaagtcattagtgaccctcttgatgattttggt
ggtgttccttctgaggaggctgatgaaacacagcggcaaccaagaagtcatcaagtcaat
gatgttcgactgagaagtgccggtgaggcttctcaaaggagcactagagaagattgggct
gaatggatgaggcacttcagtattgcgcttctcaaagaatcaccatctcctgctttacgc
acttgcgcaagactagcacaacttcagccttctgttggtcgtgagttgtttgctgcgggc
tttgcaagttgctgggcccaaatgaatgaaacatcccaggagcaacttgtgagaagtctc
aagactgcattctcatctcagaacatacctccagaaattcttgccacactgctgaacttg
gcagagtttatggaacatgatgagaagccgcttccaattgatacaagactgctcggtgca
cttgctgaaaagtgtcgagcatttgcaaaagcactgcattataaagaaatggagtttgaa
gctgtatgttccaagaagatgggtgcaaatcctgttactgttgttgaatctcttattcat
attaacaaccaattacaccagcatgaggcagctattgggatattgacttactcacaacaa
catttagaagttcaattgaaggagtcctggtacgaaaaattgcaccgttgggatgaggcc
ttgaaggcatacaaagcaaagtcatctcaagcatctgggccattacaaaacttggatgct
acattaggtcgaatgaggtgtctagcagccttggcccgttgggaagatttaagtgcatta
tgcagggagcaatggactggctcagaaccatctgcccgactagaaatggctccgatggct
gccaatgctgcttggcatatgggtgagtgggaccacatggctgaatatgtttctcgtctg
gatgatggggatgaaaacaagctccggatattgggtaacacaacagctagtggtgacgga
agcagcaatggtgctttctttagggctgttctttcagttcgttgcaaaaagtatgaagaa
gctcgtgtatatgttgagagagctcggcggtgtttggctacagaacttgcagcattggta
cttgagagttatgagcgtgcttataataatatggtgcgggttcaacagctttctgagctg
gaagaggtgattgattactgcactcttccaatggaaagtccaatagctgacagccggagg
gaacttatccgtaatatgtggaatgagcgtattaaaggaacaaaacggaatgttgaggtg
tggcaagccttacttgctgttagagagttggttctccctcctaatgaagacagagacacc
tggataaaatttgccaaactttgctggaagagtggccgcattagtcaggctaaatctacc
ttagtcaaactcttacagtttgatccagaatcttcccctgaattgacgctgtatcatgga
catcctcaagtagtcctggcatacctgaagtaccagtatgctgttggagatgagcttaaa
cgaagggacgcgttttgcaggctacaggatttgtctgtgcagcttgctaccgcaacaaat
agttattctggaacattagcaagccaggttgccacatcaaatgctggagtaccacttatt
gctcgcgtctatttgacacttgctagctggaagagagcattatcacctgggttagacgat
gattctattcaagaaatattggtctcttacaaaaatgccacacttaatgccaaggactgg
ggcaaggcatggcacttatgggccttgttcaacactgaagtcatgtcccgctatactttg
cgtggtcgaccagatattgcaggaaaatatgttgttgcagcagtaactgggtatttctac
tctattgcttgcgcatccacgacaaaaggtgttgatgatagcttacaggatatccttcgt
ctcttgactctttggtttaatcatggggctacctcagaggttcaaatggcactgcagaaa
ggcttttcacttgtcaatatagaaatgtggttggttgtccttccccagataattgcaagg
atccattcaaataataaaatagtgagagaactgatacagtcattgctggttcgaattgga
aaggatcatccacaggcattgatgtatcctctgttggttgcttgcaaatcaataagcata
ttaagacaacgagcggcgcaagaggtcgtcgataagatccgccaacatagtggaggtctt
gttgatcaggcacagcttgtttcaaaggaactgatacgagttgccattctgtggcatgag
atgtggcatgaggctcttgaggaagctagcaggatgtattttggtgagcacaatattgag
ggaatgcttgcagtgcttgaaccattgcatgcaatgctcgagaggggtcctgagacaata
aaagaaaatactttcattcaggcttatggtcatgaattactggaagcccacgaatgctgt
ttaaaatatcgggctacaggagaggatgctgagttaactaaggcatgggatttgtattac
catgttttcagaagaatagacaaacagcttccaagtcttacaactttggatttgcactct
gtgtcacccgagcttcttgagtgtcgaaagttggagcttgctgtaccaggaacttattct
gcagatgcaccacttgtgacaattgagtattttgttcctcaattgattgttataacatct
aaacaaagaccaagaaaactgacaattcatggaagtgatggcaacgattatgcattcttg
ctgaaaggccatgaagatttacggcaggatgagcgtgtaatgcagctttttggcctggtg
aatactctgctggagaactctaggaaaacttcagagaaagatctgtcaatccaaagatat
gctgtcatacctttgtctcctaacagtggtttaattggatgggttccaaattgtgacaca
cttcatgccctgatccgtgaatatagagatgccaggaagattttcttaaatcaggagcac
cgatgtatgttgagttttgcacctgattatgaccacttacccctcatcgccaaagtagaa
gtatttcagcatgccctagaaaacagtgaaggaaatgaccttgcaaaggttctctggctt
aaaagccgaacctctgaagtatggcttgagcggcgcacaaattatacgagaagtctggct
gttatgagcatggttggctatttgcttggtttaggagatcggcatccaagtaatcttatg
ttagatcgttatagtggaaaaatattacatattgactttggcgattgctttgaggcttca
atgaatcgtgaaaagtttcccgaaaaggttccatttcgcttgactagaatgcttgtgaaa
gccatggaagttagtggtattgagggtaccttcagaaccacttgcgaaaatgtgatgcaa
gtacttcgaacaaacaaggatagcgttatggctatgatggaggcatttgtgcatgaccca
ttaatcaattggcgtctgttcaatttcaatgaagtccctcaagttacaaactatggaaat
gctcacagtcacacagttgtcaatagcgaagaagctgctaatcgggagctcatgcaacca
ccccggggagctcgggagagagaactgctacaggcggtcaatcaactcggtgatgctaac
gaggttttgaatgagcgtgccgtagctgtgatggcacgaatgagtcataagctcacaggg
cgcgatttctcttccggatcatcgttgtcgggggcgggaagctccacccaacatggtaac
gagcatctggcttcaggagacactcgagaggtggaacctggtttatccgtgaaggttcag
gttcagaggcttatacttcaagcgacttcgcatgaaaacttgtgccaaaactacgtcggg
tggtgcccgttttggtga

DBGET integrated database retrieval system