KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338174Help
Entry
4338174           CDS       T01015                                 

Definition
Os05g0235300
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1427 aa AA seqDB search
LVDIRRRAIVTLTKLIPTVQVGTHVSVLVHHLKLVLDGNNDDLRKDAAEALCCLAHALGE
DFTIFVSSIHKLLVKHHMRYRKWDEIENRLLRREPLISENLSVQKYTQCPPEVISDPLDD
FGGVPSEEADETQRQPRSHQVNDVRLRSAGEASQRSTREDWAEWMRHFSIALLKESPSPA
LRTCARLAQLQPSVGRELFAAGFASCWAQMNETSQEQLVRSLKTAFSSQNIPPEILATLL
NLAEFMEHDEKPLPIDTRLLGALAEKCRAFAKALHYKEMEFEAVCSKKMGANPVTVVESL
IHINNQLHQHEAAIGILTYSQQHLEVQLKESWYEKLHRWDEALKAYKAKSSQASGPLQNL
DATLGRMRCLAALARWEDLSALCREQWTGSEPSARLEMAPMAANAAWHMGEWDHMAEYVS
RLDDGDENKLRILGNTTASGDGSSNGAFFRAVLSVRCKKYEEARVYVERARRCLATELAA
LVLESYERAYNNMVRVQQLSELEEVIDYCTLPMESPIADSRRELIRNMWNERIKGTKRNV
EVWQALLAVRELVLPPNEDRDTWIKFAKLCWKSGRISQAKSTLVKLLQFDPESSPELTLY
HGHPQVVLAYLKYQYAVGDELKRRDAFCRLQDLSVQLATATNSYSGTLASQVATSNAGVP
LIARVYLTLASWKRALSPGLDDDSIQEILVSYKNATLNAKDWGKAWHLWALFNTEVMSRY
TLRGRPDIAGKYVVAAVTGYFYSIACASTTKGVDDSLQDILRLLTLWFNHGATSEVQMAL
QKGFSLVNIEMWLVVLPQIIARIHSNNKIVRELIQSLLVRIGKDHPQALMYPLLVACKSI
SILRQRAAQEVVDKIRQHSGGLVDQAQLVSKELIRVAILWHEMWHEALEEASRMYFGEHN
IEGMLAVLEPLHAMLERGPETIKENTFIQAYGHELLEAHECCLKYRATGEDAELTKAWDL
YYHVFRRIDKQLPSLTTLDLHSVSPELLECRKLELAVPGTYSADAPLVTIEYFVPQLIVI
TSKQRPRKLTIHGSDGNDYAFLLKGHEDLRQDERVMQLFGLVNTLLENSRKTSEKDLSIQ
RYAVIPLSPNSGLIGWVPNCDTLHALIREYRDARKIFLNQEHRCMLSFAPDYDHLPLIAK
VEVFQHALENSEGNDLAKVLWLKSRTSEVWLERRTNYTRSLAVMSMVGYLLGLGDRHPSN
LMLDRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGTFRTTCENV
MQVLRTNKDSVMAMMEAFVHDPLINWRLFNFNEVPQVTNYGNAHSHTVVNSEEAANRELM
QPPRGARERELLQAVNQLGDANEVLNERAVAVMARMSHKLTGRDFSSGSSLSGAGSSTQH
GNEHLASGDTREVEPGLSVKVQVQRLILQATSHENLCQNYVGWCPFW
NT seq 4284 nt NT seq  +upstreamnt  +downstreamnt
ctagttgatatcagacgccgtgccattgtcactttgactaaactcatacctacggtgcag
gttggtactcatgtttcggttttggtgcatcatctaaagctagttttggatggaaacaat
gatgatctacggaaagatgcagcagaggcgctttgttgtcttgcacatgctcttggagaa
gattttacaatattcgtgtcatcaatacacaagcttcttgtgaagcaccatatgcggtat
agaaaatgggatgagattgaaaatcgattactaaggcgagagccactcatctctgagaac
ttatcagtacaaaagtacacacaatgcccgcctgaagtcattagtgaccctcttgatgat
tttggtggtgttccttctgaggaggctgatgaaacacagcggcaaccaagaagtcatcaa
gtcaatgatgttcgactgagaagtgccggtgaggcttctcaaaggagcactagagaagat
tgggctgaatggatgaggcacttcagtattgcgcttctcaaagaatcaccatctcctgct
ttacgcacttgcgcaagactagcacaacttcagccttctgttggtcgtgagttgtttgct
gcgggctttgcaagttgctgggcccaaatgaatgaaacatcccaggagcaacttgtgaga
agtctcaagactgcattctcatctcagaacatacctccagaaattcttgccacactgctg
aacttggcagagtttatggaacatgatgagaagccgcttccaattgatacaagactgctc
ggtgcacttgctgaaaagtgtcgagcatttgcaaaagcactgcattataaagaaatggag
tttgaagctgtatgttccaagaagatgggtgcaaatcctgttactgttgttgaatctctt
attcatattaacaaccaattacaccagcatgaggcagctattgggatattgacttactca
caacaacatttagaagttcaattgaaggagtcctggtacgaaaaattgcaccgttgggat
gaggccttgaaggcatacaaagcaaagtcatctcaagcatctgggccattacaaaacttg
gatgctacattaggtcgaatgaggtgtctagcagccttggcccgttgggaagatttaagt
gcattatgcagggagcaatggactggctcagaaccatctgcccgactagaaatggctccg
atggctgccaatgctgcttggcatatgggtgagtgggaccacatggctgaatatgtttct
cgtctggatgatggggatgaaaacaagctccggatattgggtaacacaacagctagtggt
gacggaagcagcaatggtgctttctttagggctgttctttcagttcgttgcaaaaagtat
gaagaagctcgtgtatatgttgagagagctcggcggtgtttggctacagaacttgcagca
ttggtacttgagagttatgagcgtgcttataataatatggtgcgggttcaacagctttct
gagctggaagaggtgattgattactgcactcttccaatggaaagtccaatagctgacagc
cggagggaacttatccgtaatatgtggaatgagcgtattaaaggaacaaaacggaatgtt
gaggtgtggcaagccttacttgctgttagagagttggttctccctcctaatgaagacaga
gacacctggataaaatttgccaaactttgctggaagagtggccgcattagtcaggctaaa
tctaccttagtcaaactcttacagtttgatccagaatcttcccctgaattgacgctgtat
catggacatcctcaagtagtcctggcatacctgaagtaccagtatgctgttggagatgag
cttaaacgaagggacgcgttttgcaggctacaggatttgtctgtgcagcttgctaccgca
acaaatagttattctggaacattagcaagccaggttgccacatcaaatgctggagtacca
cttattgctcgcgtctatttgacacttgctagctggaagagagcattatcacctgggtta
gacgatgattctattcaagaaatattggtctcttacaaaaatgccacacttaatgccaag
gactggggcaaggcatggcacttatgggccttgttcaacactgaagtcatgtcccgctat
actttgcgtggtcgaccagatattgcaggaaaatatgttgttgcagcagtaactgggtat
ttctactctattgcttgcgcatccacgacaaaaggtgttgatgatagcttacaggatatc
cttcgtctcttgactctttggtttaatcatggggctacctcagaggttcaaatggcactg
cagaaaggcttttcacttgtcaatatagaaatgtggttggttgtccttccccagataatt
gcaaggatccattcaaataataaaatagtgagagaactgatacagtcattgctggttcga
attggaaaggatcatccacaggcattgatgtatcctctgttggttgcttgcaaatcaata
agcatattaagacaacgagcggcgcaagaggtcgtcgataagatccgccaacatagtgga
ggtcttgttgatcaggcacagcttgtttcaaaggaactgatacgagttgccattctgtgg
catgagatgtggcatgaggctcttgaggaagctagcaggatgtattttggtgagcacaat
attgagggaatgcttgcagtgcttgaaccattgcatgcaatgctcgagaggggtcctgag
acaataaaagaaaatactttcattcaggcttatggtcatgaattactggaagcccacgaa
tgctgtttaaaatatcgggctacaggagaggatgctgagttaactaaggcatgggatttg
tattaccatgttttcagaagaatagacaaacagcttccaagtcttacaactttggatttg
cactctgtgtcacccgagcttcttgagtgtcgaaagttggagcttgctgtaccaggaact
tattctgcagatgcaccacttgtgacaattgagtattttgttcctcaattgattgttata
acatctaaacaaagaccaagaaaactgacaattcatggaagtgatggcaacgattatgca
ttcttgctgaaaggccatgaagatttacggcaggatgagcgtgtaatgcagctttttggc
ctggtgaatactctgctggagaactctaggaaaacttcagagaaagatctgtcaatccaa
agatatgctgtcatacctttgtctcctaacagtggtttaattggatgggttccaaattgt
gacacacttcatgccctgatccgtgaatatagagatgccaggaagattttcttaaatcag
gagcaccgatgtatgttgagttttgcacctgattatgaccacttacccctcatcgccaaa
gtagaagtatttcagcatgccctagaaaacagtgaaggaaatgaccttgcaaaggttctc
tggcttaaaagccgaacctctgaagtatggcttgagcggcgcacaaattatacgagaagt
ctggctgttatgagcatggttggctatttgcttggtttaggagatcggcatccaagtaat
cttatgttagatcgttatagtggaaaaatattacatattgactttggcgattgctttgag
gcttcaatgaatcgtgaaaagtttcccgaaaaggttccatttcgcttgactagaatgctt
gtgaaagccatggaagttagtggtattgagggtaccttcagaaccacttgcgaaaatgtg
atgcaagtacttcgaacaaacaaggatagcgttatggctatgatggaggcatttgtgcat
gacccattaatcaattggcgtctgttcaatttcaatgaagtccctcaagttacaaactat
ggaaatgctcacagtcacacagttgtcaatagcgaagaagctgctaatcgggagctcatg
caaccaccccggggagctcgggagagagaactgctacaggcggtcaatcaactcggtgat
gctaacgaggttttgaatgagcgtgccgtagctgtgatggcacgaatgagtcataagctc
acagggcgcgatttctcttccggatcatcgttgtcgggggcgggaagctccacccaacat
ggtaacgagcatctggcttcaggagacactcgagaggtggaacctggtttatccgtgaag
gttcaggttcagaggcttatacttcaagcgacttcgcatgaaaacttgtgccaaaactac
gtcgggtggtgcccgttttggtga

DBGET integrated database retrieval system