KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338261Help
Entry
4338261           CDS       T01015                                 

Definition
Os05g0270800
Orthology
K00601  
phosphoribosylglycinamide formyltransferase [EC:2.1.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    4338261
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4338261
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     4338261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 234 aa AA seqDB search
MRRWGRGRRGGEARGVGVERKRLVVFVSGGGSNFRAIHDAALGGDVNGVVVALVTDKPGC
GGAEHARGNGIPVVVFPKLKSAPEGVSTDELLNGLRELRVDFILLAGYLKLIPVELVQAY
PKSILNIHPSLLPAFGGKGYYGLKVHKAVIASGARYSGPTVHFVDEHYDTGRTLAQRVVP
VQANDTPEQLATRVLHEEHQVYVEAVTALCEDRIVWREDGIPLIRSQTNPDEYT
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggtgggggcgggggcgaagggggggtgaggctaggggtgtcggggtggagagg
aagaggctcgtggtgttcgtgtccggtgggggatccaacttccgggcgatccacgatgcc
gctctgggtggggacgtgaatggcgttgtggttgcgttggttaccgataaaccaggctgt
ggaggagcagagcatgcgaggggtaatggcataccggtcgttgtgttccctaagttgaag
tctgctccagagggggtatctactgatgagctgttgaatggtctgagggaactcagggta
gacttcattctacttgctggctacctgaagcttataccggttgagctagttcaggcatat
ccaaaatccattttgaatattcacccttcactactcccggcatttggaggcaaaggttat
tatggtttgaaggtgcataaagcagtcatcgcatcaggagccaggtactcgggtccaact
gtgcactttgtggatgagcactatgacacaggaaggactctagcccaaagggttgtacct
gtgcaagccaatgatactccagagcaattggctacaagagtccttcatgaggaacatcag
gtttatgttgaggcagttactgccctatgtgaggaccgaattgtgtggagagaagatggt
atcccacttattagaagccagacaaatcccgatgagtacacttaa

DBGET integrated database retrieval system