KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338261Help
Entry
4338261           CDS       T01015                                 

Definition
Os05g0270800
Orthology
K00601  
phosphoribosylglycinamide formyltransferase [EC:2.1.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:osa00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:osa00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 234 aa AA seqDB search
MRRWGRGRRGGEARGVGVERKRLVVFVSGGGSNFRAIHDAALGGDVNGVVVALVTDKPGC
GGAEHARGNGIPVVVFPKLKSAPEGVSTDELLNGLRELRVDFILLAGYLKLIPVELVQAY
PKSILNIHPSLLPAFGGKGYYGLKVHKAVIASGARYSGPTVHFVDEHYDTGRTLAQRVVP
VQANDTPEQLATRVLHEEHQVYVEAVTALCEDRIVWREDGIPLIRSQTNPDEYT
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggtgggggcgggggcgaagggggggtgaggctaggggtgtcggggtggagagg
aagaggctcgtggtgttcgtgtccggtgggggatccaacttccgggcgatccacgatgcc
gctctgggtggggacgtgaatggcgttgtggttgcgttggttaccgataaaccaggctgt
ggaggagcagagcatgcgaggggtaatggcataccggtcgttgtgttccctaagttgaag
tctgctccagagggggtatctactgatgagctgttgaatggtctgagggaactcagggta
gacttcattctacttgctggctacctgaagcttataccggttgagctagttcaggcatat
ccaaaatccattttgaatattcacccttcactactcccggcatttggaggcaaaggttat
tatggtttgaaggtgcataaagcagtcatcgcatcaggagccaggtactcgggtccaact
gtgcactttgtggatgagcactatgacacaggaaggactctagcccaaagggttgtacct
gtgcaagccaatgatactccagagcaattggctacaagagtccttcatgaggaacatcag
gtttatgttgaggcagttactgccctatgtgaggaccgaattgtgtggagagaagatggt
atcccacttattagaagccagacaaatcccgatgagtacacttaa

DBGET integrated database retrieval system