KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338825Help
Entry
4338825           CDS       T01015                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 4338825
NCBI-ProteinID: XP_015640631
UniProt: Q0DI31
Structure
PDB: 

Jmol
Position
5
AA seq 112 aa AA seqDB search
MASFSEAPPGNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTA
NKNMAVIWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLISYLKEATS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttctcggaggctcccccgggcaaccccaaggccggcgagaagatcttcaag
accaagtgcgcccagtgccacaccgtcgacaagggcgccggccacaagcaaggtccaaac
ttgaatggtctgtttggaaggcagtcaggtaccacccctggttattcctactctacggcc
aacaagaacatggctgtgatctgggaggagaacacactttatgactacctgcttaatcct
aagaagtacatccctggaaccaagatggtcttccctgggttgaagaagccacaggagcgt
gctgatcttatttcctacctgaaggaagcaacctcttaa

DBGET integrated database retrieval system