KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338979Help
Entry
4338979           CDS       T01015                                 

Definition
Os05g0455500
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:osa01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:osa00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 716 aa AA seqDB search
MASVDPSRSFVRDVKRVIIKVGTAVVSRQDGRLALGRVGALCEQVKELNSLGYEVILVTS
GAVGVGRQRLRYRKLVNSSFADLQKPQMELDGKACAAVGQSGLMALYDMLFNQLDVSSSQ
LLVTDSDFENPKFREQLTETVESLLDLKVIPIFNENDAISTRKAPYEDSSGIFWDNDSLA
GLLALELKADLLILLSDVDGLYSGPPSEPSSKIIHTYIKEKHQQEITFGDKSRVGRGGMT
AKVKAAVLASNSGTPVVITSGFENRSILKVLHGEKIGTLFHKNANLWESSKDVSTREMAV
AARDCSRHLQNLSSEERKKILLDVADALEANEDLIRSENEADVAAAQVAGYEKPLVARLT
IKPGKIASLAKSIRTLANMEDPINQILKKTEVADDLVLEKTSCPLGVLLIVFESRPDALV
QIASLAIRSGNGLLLKGGKEAIRSNTILHKVITDAIPRNVGEKLIGLVTTRDEIADLLKL
DDVIDLVIPRGSNKLVSQIKASTKIPVLGHADGICHVYIDKSADMDMAKHIVMDAKIDYP
AACNAMETLLVHKDLMKSPGLDDILVALKTEGVNIYGGPIAHKALGFPKAVSFHHEYSSM
ACTVEFVDDVQSAIDHIHRYGSAHTDCIVTTDDKVAETFLRRVDSAAVFHNASTRFSDGA
RFGLGAEVGISTGRIHARGPVGVEGLLTTRWILRGRGQVVNGDKDVVYTHKSLPLQ
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgtcgacccgtcccggagcttcgtgagggacgtgaagcgcgtcatcatcaag
gtgggcactgcagttgtctccagacaagatggaagattggctttgggcagggttggagct
ctgtgcgagcaggttaaggaactgaactctttaggatacgaagtgattttggtcacctca
ggtgctgttggagtggggcgacagcgacttaggtaccggaagcttgtcaatagcagcttt
gctgatctgcaaaagccacagatggagttagatggaaaggcttgtgccgctgttggtcag
agtggactgatggctctttacgatatgttgtttaaccaactggatgtctcgtcatctcaa
cttcttgtcaccgacagtgattttgagaacccaaagttccgggagcaactcactgaaact
gttgagtcattattagatcttaaagttataccaatatttaatgaaaatgatgccatcagc
actagaaaggctccatatgaggattcatctggtatattctgggataatgacagtttagca
ggactgttggcactggaactgaaagctgatctccttattctgctcagtgatgtggatggg
ttgtatagtggtccaccaagtgaaccatcatcaaaaatcatacacacttatattaaagaa
aagcatcagcaagaaatcacttttggagacaaatctcgtgtaggtagaggaggcatgaca
gcaaaagtgaaggctgctgtcttggcttcaaatagcggcacacctgtggttattacaagt
gggtttgaaaatcggagcattcttaaagttcttcatggggaaaaaattggtactctcttt
cacaagaatgcgaatttgtgggaatcatctaaggatgttagtactcgtgagatggctgtt
gccgcaagagattgttcaaggcatctacagaatttgtcatcagaggaacgaaaaaagata
ttgctagatgttgcagatgctttggaggcaaatgaggatttaataaggtctgagaatgaa
gctgatgtagctgcggcccaagttgctggatatgagaagcctttggttgctagattgact
ataaaaccaggaaagatagcaagccttgcaaaatctattcgtacccttgcaaatatggaa
gaccctataaaccagatacttaaaaagacagaggttgctgatgatttagttcttgagaaa
acatcttgcccattaggtgttctcttaattgtttttgagtcccgacctgatgccttggtt
cagattgcatctttggcaattcgaagtggtaatggtcttctcctaaaaggtggaaaagaa
gctatcagatcaaacacgatattgcataaggttataactgatgctattcctcgtaatgtt
ggtgaaaaacttattggccttgttacaactagagatgagatcgcagatttgctaaagctt
gatgatgtcattgatcttgtcattccaagaggaagtaataagcttgtctctcaaatcaag
gcgtcaactaagattcctgttcttgggcatgctgatggtatatgccacgtatatattgac
aaatcagctgacatggatatggcaaaacatattgtaatggatgcaaaaattgattaccca
gcagcctgcaatgcaatggagaccttactagttcataaggatcttatgaagagtccaggc
cttgacgacatattagtagcactaaaaacagaaggagttaatatttatggtggacctatt
gcgcacaaagctctgggatttccaaaagctgtttcatttcatcatgagtatagttctatg
gcctgcactgttgagtttgttgatgatgttcaatcagcaattgaccatattcatcgttat
ggaagtgctcatacagattgtatcgtcactacagatgataaggtagcagagacttttcta
cgcagagttgatagtgctgctgtatttcataatgcaagtacgagattctctgatggggct
cgttttggattgggtgctgaggttggcataagcacagggcgtatccatgcccgtggacca
gtgggtgttgaaggtctcttaactacacgatggatcttgcgagggcgtgggcaagtggtg
aatggtgacaaggatgtcgtgtacacccataagagtcttcctttgcaatga

DBGET integrated database retrieval system