KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339153Help
Entry
4339153           CDS       T01015                                 

Definition
Os05g0488900
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4339153
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     4339153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 282 aa AA seqDB search
MEFLQGQSTETAVAVAVAVVAVAAGAAFLLLLLRSSKKPKGCLDPENFKEFKLVEKRQIS
HNVAKFRFALPTPASVLGLPIGQHISCRGQDATGEEVIKPYTPTTLDSDLGRFELVIKMY
PQGRMSHHFHEMKVGDYLSVRGPKGRFKYQPGQVRAFGMLAGGSGITPMFQVTRAILENP
SDNTKVHLIYANVTYDDILLKEELDSMVETYPDRFKIYYVLNQPPEIWNGGVGFVSMEMI
QTHCPAPAADIQILRCGPPPMNKAMAEHLENLGYTKEMQFQF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggagttcctgcaggggcagagcacggagaccgccgtggccgtggcggtggccgtcgtc
gccgtggccgccggcgccgccttcctcctcctcctcctccgcagcagcaagaagcccaag
ggctgcttggaccctgagaacttcaaggagtttaagcttgtggagaagaggcagatcagt
cataatgtggccaagttcagatttgctctaccaacccctgcttctgtgctggggcttcca
attggccaacatatcagttgcagagggcaggatgctactggcgaggaagtaatcaagcct
tatactccaactacgctggattctgatcttggacggtttgagcttgttattaagatgtat
ccccaaggaagaatgtctcatcattttcatgagatgaaagttggtgactatttatctgtg
agaggacctaagggtcgcttcaaataccaacctgggcaagtaagagcatttggaatgtta
gctggaggatcaggcattaccccaatgttccaagtcacaagagcaattcttgaaaaccca
agtgacaatacgaaagtgcacttaatctatgccaatgtcacatatgatgacattcttcta
aaggaagaattggatagtatggttgaaacctatcccgatcgcttcaagatatactatgta
ttaaatcagcctccagaaatctggaatggtggtgttgggtttgtgtcaatggaaatgatc
caaacccattgcccggcacctgctgctgacattcagatattgagatgcggacctcctccc
atgaacaaagccatggctgaacacctggagaatcttggctacacgaaggaaatgcagttc
caattctaa

DBGET integrated database retrieval system