KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339203Help
Entry
4339203           CDS       T01015                                 

Definition
Os05g0496100
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    4339203
Translation factors [BR:osa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    4339203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 216 aa AA seqDB search
MASWDDDEFSDEEEQSMGKRLWEDEDAGDDFAAVKDTWDDDDDVKPGKETAATAASTKPP
ATKGKKSQANAKAKAEAADATPSETSTSNAAAEIAQKQPDDDEPIEKFVPKSEKEFAEYA
ERIAKDLLRPYEKSYHYIGLMKAMNKLAVASLTSTSVKEIVSSMTTVANEKLKAEKAADA
GKKKPGQKKKRLHVNKAEGQKFRDADDDDDDDCLSS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcgagttgggatgacgatgaattttccgatgaggaagaacagtctatgggaaaaagg
ctttgggaggacgaagacgccggcgacgacttcgccgcggtgaaggacacgtgggacgac
gacgacgacgttaaacctgggaaggagacggccgccacggcggcgagcacgaaacctcct
gcaaccaaagggaagaagagccaggccaacgcgaaggcgaaggcagaagcagcagacgca
acaccgagtgaaacctctacctcgaatgccgctgctgagatagctcagaagcagcctgac
gacgacgaacccatcgagaagttcgtcccaaaatcggagaaggaattcgccgagtacgcc
gagcgcatcgcgaaagatcttcttagaccttacgagaaaagctaccattacattggtctt
atgaaggcgatgaacaagctcgccgtggcgtcgctgacgtcgacgagcgtgaaggagatc
gtgtcgtccatgacgacggtggccaacgagaagctcaaggccgagaaggcggccgacgcc
ggcaagaagaagccagggcagaagaagaagaggcttcacgtcaacaaggccgaagggcaa
aagtttcgtgatgctgacgacgacgacgacgacgattgtctatcatcttaa

DBGET integrated database retrieval system