KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339356Help
Entry
4339356           CDS       T01015                                 

Definition
Os05g0521600
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4339356
   00500 Starch and sucrose metabolism
    4339356
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     4339356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 398 aa AA seqDB search
MAVSVSWSWAPRFLACVAVAVLLVTSGLGGAAAGGGGRRHGHTKGLRPGKAAAKPYYPVN
ATAVEAIERQFTRWVRSMVGRRHSTFQRALYRGLLPTRTLVVDKNPAAGNFTSIQAAVDS
IPLINLARVVIKVNAGTYTEKVTISPLRAFVTIEGAGADKTVVQWGDTADTVGPLGRPFG
TFASATFAVNAQFFVAKNITFKNTAPVPRPGALGKQGVALRISADNAAFLGCNFLGAQDT
LYDHLGRHYYRDCYIEGSVDFIFGNALSLYEGCHVHAIARNYGALTAQNRMSILEDTGFS
FVNCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIIIPRGWYNWGDPTREMTVFYGQYKCT
GPGSNYAGRVAWSRELTDQEAKPFISLSFIDGLEWVKL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtccgtgtcgtggtcgtgggcgccgcggttcttggcctgcgtcgcggtggcg
gtgttgcttgttacgtcgggtttgggcggtgcggccgccggcggcggcgggcgacgccat
gggcacacgaaggggttgcggccggggaaggcggcggcgaagccgtactatccggtgaac
gcgacggcggtggaggcgatcgagcggcagttcacgcggtgggtgcggtccatggtcggg
cgacgccacagcacgttccagcgcgcgctctaccgcgggctgctgcccacgcgcaccctc
gtcgtcgacaagaaccccgccgccggcaacttcacgtccatccaggccgccgtcgactcg
atcccgctcatcaacctcgcccgcgtcgtcatcaaggtcaatgccggcacatacactgag
aaggtgaccatctcgccgctccgcgcgttcgtgaccatcgagggcgccggcgcggacaag
acggtggtgcagtggggcgacacggccgacacggtcggcccgctcgggcgccccttcggc
accttcgcctccgccacgttcgccgtcaacgcgcagttcttcgtcgccaagaacatcacc
ttcaagaacacggcgccggtgccgaggccgggggcgctggggaagcagggtgtggcgctg
cggatatcggcggacaacgcggcgttcttggggtgcaacttcctcggcgcgcaggacacg
ctgtacgaccacctcggccgccattactacagagactgctacatcgagggctccgtcgac
ttcatattcggcaacgccctctctctctacgagggatgtcacgtgcacgcgatcgcgcgg
aactacggagccctgacggctcagaaccggatgagcatcctggaggacacgggtttctcg
ttcgtcaactgccgcgtgacgggctccggcgccctctacctcggccgcgcctggggcacc
ttctcccgcgtcgtcttcgcctacacctacatggacaacatcatcatcccccgcggctgg
tacaactggggcgatcccacccgcgagatgacggtgttctacgggcagtacaagtgcacg
gggccgggttcgaactacgccgggagggtggcgtggtcgagggagctcacggaccaggag
gccaagccgttcatctccctcagcttcatcgacgggttggagtgggtcaagttgtag

DBGET integrated database retrieval system