KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339457Help
Entry
4339457           CDS       T01015                                 

Definition
Os05g0539400
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:osa00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:osa00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:osa00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:osa00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:osa00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 673 aa AA seqDB search
MGPSRSFQNLLLLLLPLALALCSAAASGEASRRFWVENDTFWKDGAPFQIVGGDVHYFRI
VPEYWKDRLLRAKALGLNTIQTYVPWNLHEPKPLSWEFKGFTDIESYLRLAHELDMLVML
RVGPYICGEWDLGGFPPWLLTIEPTIELRSSDSTYLSLVDRWWGVLLPKIAPLLYSNGGP
IIMVQIENEFGSFGDDKNYLHYLVEVARRYLGNDIMLYTTDGGAIGNLKNGTILQDDVFA
AVDFDTGSNPWPIFQLQKEYNLPGKSAPLSSEFYTGWLTHWGERIATTDASSTAKALKRI
LCRNGSAVLYMAHGGTNFGFYNGANTGQNESDYKADLTSYDYDAPIREYGDVHNAKYKAL
RRVIHECTGIPLLQLPSKIERASYGLVEVQKVASLFDVIHNISDALKVAFSEQPLSMELM
GQMFGFLLYTSEYQEKHSSSILSIPKVHDRAQVFVSCSHGDVRKPRYVGIVERWSSKTLQ
IPSLSCSSNVSLYILVENMGRVNYGPYIFDQKGILSSVEIDGIILRHWKMHPVSLNAVGN
LSKLQLIMQMTDAEASKVSIYGDSENKLQDVSLYLNEGISEEPAFYEGHFHIDSESEKKD
TFISFRGWNKGVAFVNNFNIGRFWPAIGPQCALYVPAPILKPGDNVIVIFELHSPNPELT
IKLVKDPDFTCGQ
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggggccgtccagaagcttccagaaccttcttctcctcctcctccccctcgcgctggcc
ctgtgctccgccgcggccagcggggaggcttcgagaaggttctgggtcgagaacgacacc
ttctggaaggatggcgccccgttccagatcgtcggcggcgacgttcactacttccgcatt
gtccctgagtactggaaagatcgccttttaagggcaaaggcgctgggcttgaacacaatt
cagacatatgttccttggaatctgcatgagccaaaaccgctgagctgggaattcaagggt
ttcacagatattgaatcatatttaagacttgctcatgaattagatatgctggtcatgctt
cgtgtaggtccatatatttgtggagaatgggacttggggggatttccaccttggttactg
accatagaaccaaccatcgaactgcgttcttcagattcaacctatctttccttggtggac
agatggtggggagtactactcccaaaaatcgcaccactattatacagcaatggaggtcct
atcatcatggtgcagattgaaaatgaatttggttcatttggagatgacaagaattatctt
cattaccttgttgaagttgccagaagatatcttgggaatgacattatgctgtatacaact
gatggtggtgccattggaaatctaaagaatggaacaattcttcaggatgatgttttcgct
gctgttgattttgatactggttccaatccatggccaatatttcaactacagaaggaatac
aacttgccaggaaaatcagctcctttaagctcagaattttacactggatggctaacacac
tggggggaaagaattgcaacaactgatgctagcagtacagctaaagctcttaaaagaatt
ttgtgccgcaacggttctgctgtactttatatggctcatggtgggactaattttgggttt
tacaatggtgcaaatactggtcaaaatgaatctgactacaaggcagacctcacttcatat
gactatgatgcaccaattagggagtatggggacgtgcataatgcaaaatacaaagcacta
agaagagttatacatgaatgcactggcattcctcttctccaacttccttccaaaattgaa
agagctagttatgggcttgtagaagtacagaaggtcgcttctttgtttgatgtcattcat
aacatcagtgatgctctgaaagtggctttttcagagcagcctctatccatggaactgatg
ggccagatgtttggttttctactgtacacatcagaatatcaagaaaaacattcatccagc
atcctatcaattccaaaggtacatgacagagctcaagtgtttgtgtcctgctcacacggt
gatgtcagaaaaccgagatatgttggcatagttgaaagatggtcgagtaaaacactacaa
ataccaagcttaagctgctcatctaatgtcagcttatatatcctggtagaaaacatgggt
cgagtaaattatggaccatatatttttgaccagaagggcatactatcttctgttgaaata
gatggcattattctccgtcactggaaaatgcatccggtttcacttaatgcggtgggcaac
ctttcaaaacttcaactaatcatgcagatgactgatgctgaagctagcaaagtatccatt
tatggtgattcagaaaataagttgcaggatgtatcgctctatctaaatgaagggatttca
gaggaaccggcattctatgaaggccattttcatattgactctgaatctgagaaaaaggac
acattcatatcatttcgaggttggaataaaggagtcgcttttgtgaacaacttcaacatt
ggaaggttctggccggccattggaccacaatgcgctctgtatgttcctgcgccgatcctc
aaacctggagataatgtcattgtgatctttgaactgcatagtccaaaccctgagctcacc
atcaagttagtgaaggatccagatttcacatgcggccagtga

DBGET integrated database retrieval system