KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339457Help
Entry
4339457           CDS       T01015                                 

Definition
Os05g0539400
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    4339457
  Lipid metabolism
   00600 Sphingolipid metabolism
    4339457
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    4339457
   00604 Glycosphingolipid biosynthesis - ganglio series
    4339457
   00511 Other glycan degradation
    4339457
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     4339457
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4339457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 673 aa AA seqDB search
MGPSRSFQNLLLLLLPLALALCSAAASGEASRRFWVENDTFWKDGAPFQIVGGDVHYFRI
VPEYWKDRLLRAKALGLNTIQTYVPWNLHEPKPLSWEFKGFTDIESYLRLAHELDMLVML
RVGPYICGEWDLGGFPPWLLTIEPTIELRSSDSTYLSLVDRWWGVLLPKIAPLLYSNGGP
IIMVQIENEFGSFGDDKNYLHYLVEVARRYLGNDIMLYTTDGGAIGNLKNGTILQDDVFA
AVDFDTGSNPWPIFQLQKEYNLPGKSAPLSSEFYTGWLTHWGERIATTDASSTAKALKRI
LCRNGSAVLYMAHGGTNFGFYNGANTGQNESDYKADLTSYDYDAPIREYGDVHNAKYKAL
RRVIHECTGIPLLQLPSKIERASYGLVEVQKVASLFDVIHNISDALKVAFSEQPLSMELM
GQMFGFLLYTSEYQEKHSSSILSIPKVHDRAQVFVSCSHGDVRKPRYVGIVERWSSKTLQ
IPSLSCSSNVSLYILVENMGRVNYGPYIFDQKGILSSVEIDGIILRHWKMHPVSLNAVGN
LSKLQLIMQMTDAEASKVSIYGDSENKLQDVSLYLNEGISEEPAFYEGHFHIDSESEKKD
TFISFRGWNKGVAFVNNFNIGRFWPAIGPQCALYVPAPILKPGDNVIVIFELHSPNPELT
IKLVKDPDFTCGQ
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggggccgtccagaagcttccagaaccttcttctcctcctcctccccctcgcgctggcc
ctgtgctccgccgcggccagcggggaggcttcgagaaggttctgggtcgagaacgacacc
ttctggaaggatggcgccccgttccagatcgtcggcggcgacgttcactacttccgcatt
gtccctgagtactggaaagatcgccttttaagggcaaaggcgctgggcttgaacacaatt
cagacatatgttccttggaatctgcatgagccaaaaccgctgagctgggaattcaagggt
ttcacagatattgaatcatatttaagacttgctcatgaattagatatgctggtcatgctt
cgtgtaggtccatatatttgtggagaatgggacttggggggatttccaccttggttactg
accatagaaccaaccatcgaactgcgttcttcagattcaacctatctttccttggtggac
agatggtggggagtactactcccaaaaatcgcaccactattatacagcaatggaggtcct
atcatcatggtgcagattgaaaatgaatttggttcatttggagatgacaagaattatctt
cattaccttgttgaagttgccagaagatatcttgggaatgacattatgctgtatacaact
gatggtggtgccattggaaatctaaagaatggaacaattcttcaggatgatgttttcgct
gctgttgattttgatactggttccaatccatggccaatatttcaactacagaaggaatac
aacttgccaggaaaatcagctcctttaagctcagaattttacactggatggctaacacac
tggggggaaagaattgcaacaactgatgctagcagtacagctaaagctcttaaaagaatt
ttgtgccgcaacggttctgctgtactttatatggctcatggtgggactaattttgggttt
tacaatggtgcaaatactggtcaaaatgaatctgactacaaggcagacctcacttcatat
gactatgatgcaccaattagggagtatggggacgtgcataatgcaaaatacaaagcacta
agaagagttatacatgaatgcactggcattcctcttctccaacttccttccaaaattgaa
agagctagttatgggcttgtagaagtacagaaggtcgcttctttgtttgatgtcattcat
aacatcagtgatgctctgaaagtggctttttcagagcagcctctatccatggaactgatg
ggccagatgtttggttttctactgtacacatcagaatatcaagaaaaacattcatccagc
atcctatcaattccaaaggtacatgacagagctcaagtgtttgtgtcctgctcacacggt
gatgtcagaaaaccgagatatgttggcatagttgaaagatggtcgagtaaaacactacaa
ataccaagcttaagctgctcatctaatgtcagcttatatatcctggtagaaaacatgggt
cgagtaaattatggaccatatatttttgaccagaagggcatactatcttctgttgaaata
gatggcattattctccgtcactggaaaatgcatccggtttcacttaatgcggtgggcaac
ctttcaaaacttcaactaatcatgcagatgactgatgctgaagctagcaaagtatccatt
tatggtgattcagaaaataagttgcaggatgtatcgctctatctaaatgaagggatttca
gaggaaccggcattctatgaaggccattttcatattgactctgaatctgagaaaaaggac
acattcatatcatttcgaggttggaataaaggagtcgcttttgtgaacaacttcaacatt
ggaaggttctggccggccattggaccacaatgcgctctgtatgttcctgcgccgatcctc
aaacctggagataatgtcattgtgatctttgaactgcatagtccaaaccctgagctcacc
atcaagttagtgaaggatccagatttcacatgcggccagtga

DBGET integrated database retrieval system