KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339521Help
Entry
4339521           CDS       T01015                                 

Definition
Os05g0549700
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    4339521
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4339521
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    4339521
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     4339521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 521 aa AA seqDB search
MAATTHAASLSFLLSHPHPTSPNPNPNPNLPLRRAPHRVRCATDAAATRHRRAADENIRE
EAARHRAPNHNFSAWYAPFPPAPNGDPDERYSLDEIVYRSSSGGLLDVRHDMDALARFPG
SYWRDLFDSRVGRTTWPFGSGVWSKKEFVLPEIDPDHIVSLFEGNSNLFWAERLGRDHLA
GMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRRAPLSRPIAGVGCASTGDTSAALSAY
CAAAGIPAIVFLPANRISLEQLIQPIANGATVLSLDTDFDGCMRLIREVTAELPIYLANS
LNSLRLEGQKTAAIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRVLGLVDRVPRL
VCAQAANANPLYRYYKSGWTEFTPQVAEPTFASAIQIGDPVSVDRAVVALKATDGIVEEA
TEEELMNAMSLADRTGMFACPHTGVALAALFKLRDQRIIGPNDRTVVVSTAHGLKFSQSK
IDYHDSKIEDMACKYANPPVSVKADFGAVMDVLKKRLKGKL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccacccacgccgcctccctctccttcctcctctctcacccccaccccacc
tcccccaaccctaaccctaaccctaacctccccctccgccgcgccccccaccgcgtccgc
tgcgccaccgacgccgccgccaccaggcaccggcgcgcggccgacgagaacatccgggag
gaggcggcgaggcaccgcgccccgaaccacaacttctccgcgtggtacgcgcccttcccg
cccgcccccaacggcgaccccgacgagcgctactccctggacgagatcgtctaccgctcc
agctcgggcggcctcctcgacgtgcgccacgacatggacgcgctcgcccgcttcccgggc
tcctactggcgcgacctcttcgactcccgcgtcggccgcaccacctggcccttcggctcc
ggcgtctggtccaagaaggagttcgtcctccccgagatcgaccccgaccacatcgtctcc
ctcttcgagggcaactccaacctcttctgggcggagcgcctcggccgcgaccacctcgcc
gggatgaacgacctctgggtcaagcactgcggcatctcccacaccggatcgttcaaggat
ctcggcatgacggtgctcgtcagccaggtgaaccgcctccgccgcgcgccgctctcccgc
cccatcgccggagtcgggtgcgcctccacgggggacacctccgccgcgctctcggcctac
tgcgccgccgcggggatcccggccattgtgttcctccccgccaaccgcatctcgctcgag
cagctcatccagcccattgccaatggcgccaccgtgctctcgctcgacacggacttcgac
ggctgcatgcggctcatcagggaggtgactgccgagctgccgatttaccttgcgaattca
ttgaattcccttcggctcgaggggcagaagactgctgctattgagattcttcagcagttc
gattgggaggtgccggattgggtcattgttcccggaggcaatcttgggaacatatatgcc
ttctacaagggattcgagatgtgccgcgtccttgggctcgtcgatcgtgtgccgcggctt
gtctgcgcgcaggctgccaatgcgaacccgctgtaccggtactacaagtcggggtggact
gagttcacgccgcaggtggctgagccgacatttgcatcggcaattcagattggtgacccg
gtatctgtcgatcgcgcggtggttgcgctcaaggcaactgatggcatcgtcgaggaggcc
acggaggaggaactcatgaacgcaatgtcgctcgctgatcgcactggcatgtttgcttgc
ccgcatactggggttgccctcgcagcactgttcaagctccgtgaccagcgcatcatcggg
ccaaatgaccgcacggtagtcgtcagcacagctcatggtctgaagttctcacagtccaag
atcgactaccatgacagcaagatcgaagacatggcctgcaagtatgcgaatcccccggtc
agcgtgaaggctgacttcggtgccgtcatggatgtcctcaagaagaggctcaagggtaag
ctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system