KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339681Help
Entry
4339681           CDS       T01015                                 

Definition
(RefSeq) histone H2B.9
  KO
K11252  histone H2B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    4339681
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4339681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 4339681
NCBI-ProteinID: XP_015637722
UniProt: Q6F362
Position
5
AA seq 152 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPAAEKAPAAGKKPKAEKRLPAGKGEKGGAGEGKKAGRKKGKK
SVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAEAAKLARYNKKPTITSR
EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagccggcggcgaagaagcccgcggaggaggagcccgcg
gcggagaaggccccggcggcggggaagaagcccaaggcggagaagcggctccccgcgggg
aagggcgagaagggcggcgccggcgaggggaagaaggccgggaggaagaaggggaagaag
agcgtggagacctacaagatctacatcttcaaggttctcaagcaggtccaccccgacatc
ggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatcttcgagaag
ctcgccgccgaggccgccaagctcgcccgctacaacaagaagcccaccatcacctcccgc
gagatccagacctccgtccgcctcgtcctccccggcgagctcgccaagcacgccgtctcc
gagggcaccaaggccgtcaccaagttcacctccgcttag

DBGET integrated database retrieval system