KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339681Help
Entry
4339681           CDS       T01015                                 

Definition
Os05g0574300
Orthology
K11252  
histone H2B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4339681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 152 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPAAEKAPAAGKKPKAEKRLPAGKGEKGGAGEGKKAGRKKGKK
SVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAAEAAKLARYNKKPTITSR
EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagccggcggcgaagaagcccgcggaggaggagcccgcg
gcggagaaggccccggcggcggggaagaagcccaaggcggagaagcggctccccgcgggg
aagggcgagaagggcggcgccggcgaggggaagaaggccgggaggaagaaggggaagaag
agcgtggagacctacaagatctacatcttcaaggttctcaagcaggtccaccccgacatc
ggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatcttcgagaag
ctcgccgccgaggccgccaagctcgcccgctacaacaagaagcccaccatcacctcccgc
gagatccagacctccgtccgcctcgtcctccccggcgagctcgccaagcacgccgtctcc
gagggcaccaaggccgtcaccaagttcacctccgcttag

DBGET integrated database retrieval system