KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339859Help
Entry
4339859           CDS       T01015                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial isoform X1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339859
   00020 Citrate cycle (TCA cycle)
    4339859
   00620 Pyruvate metabolism
    4339859
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     4339859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding QRPTase_N HTH_Tnp_Tc5
Motif
Other DBs
NCBI-GeneID: 4339859
NCBI-ProteinID: XP_015640863
Position
6
AA seq 567 aa AA seqDB search
MRRCPRFAHHLRLRSQLLRLRAEASSWLRRAHAILGCERGTVVRHFSSSTCSSLVKEDTV
SSSNLHPEYAKKIGGSDFSHDRQSGKELQNFKVSPQEASRASNFMRASKYGMPITANGVH
SLFSCGQVVPSRCFSSGADLPPHQEIGMPSLSPTMTEGNIARWVKKEGDKVSPGEVLCEV
ETDKATVEMECMEEGYLAKIIHGDGAKEIKVGEIIAVTVEEEEDIGKFKDYKAPSSAESA
APAESKPQSEPTEPKKEKEQPKAPEPKATKTEESFLSEDRTFSSPIARKLAEDNNVPLSS
IKGTGPDGRILKADIEDYLASVAKGAKKETAAAPGLGYVDLPNTQIRKVTANRLLHSKQT
IPHYYLTVDTRVDKLIKLRSELNPLQDTSGGKKISINDLVIKAAALALRNVPECNSSWMN
DFIRQYHNVNINVAVQTEDGLFVPVIRDADKKGLATIADEVKQLAQRARDNSLKPEDYEG
GTFTVSNLGGPFGIKQFCAIVNPPQSAILAIGSAEKRVIPGAEGQFEVGSFMSATLSCDH
RVIDGAIGAEWMKAFKGYIENPTTMLL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgatgcccccggtttgcccaccacctgcggctgcgctcgcaattgctgcgcctg
agggctgaggcttcttcttggttgcgaagagcgcatgctatcctcggatgcgagcgtggg
actgttgttcgtcacttctcatccagcacttgctcctctcttgtaaaggaagatactgta
tcaagttccaaccttcatccagagtatgcaaaaaaaattggaggatcagatttttcccat
gacaggcagtctggaaaagagcttcagaatttcaaggtctcaccgcaagaagcaagtaga
gcctccaatttcatgagagcatccaaatatggaatgccaattactgctaatggggtacat
agtttgttctcatgtgggcaggtagtaccgtctaggtgtttttcaagtggagcagatttg
cctccacatcaggaaatcggaatgccttcactctcccctaccatgactgagggaaacatt
gcaaggtgggtgaagaaagaaggagataaagtctcacctggtgaagttctttgtgaagta
gagactgataaagcgacagtggagatggaatgcatggaggaaggctaccttgctaaaatt
atccatggagatggtgccaaagaaattaaagttggtgagattattgccgtaaccgtggaa
gaagaggaagacatcggcaaatttaaggattataaggctccatcatctgctgaatctgca
gctccagccgaatcgaagccccaatctgagcccacagaaccaaaaaaggagaaagagcag
cccaaggctcctgagccaaaggctacaaagacagaagaatcttttctttcagaggatcgc
acattctccagtccaattgcaaggaaattggcagaagacaacaatgtaccactgtcaagc
ataaaaggtactggccccgatgggcgaattttgaaggcagatattgaggattacttggct
tctgtggccaagggtgccaagaaggaaacagcagcagctcctggactaggctatgtggat
cttcctaatacgcaaataaggaaggttactgcaaaccgcctgctgcactccaagcaaacc
attcctcactactatctgacagttgatactcgtgttgacaaacttattaagttgcgaagt
gagttgaatcctctgcaggatacctctggtggcaagaagatatccataaatgatcttgtt
atcaaggccgcagcattggctcttcgtaatgttcctgagtgtaatagctcttggatgaat
gattttattcgccaataccacaatgtgaacatcaatgttgctgtacaaactgaggatggc
ttgtttgttcccgtaataagggatgctgacaagaagggcctagccactatcgctgatgag
gtgaagcaactggctcagagagcaagggacaacagccttaagccagaggattatgagggt
ggcactttcactgtgtcaaacttgggaggcccttttggaattaagcaattctgtgccatc
gtaaatcctccacaatcagcaattttggctattggctcagctgagaagagggtgatccct
ggagctgagggtcagtttgaagttggttcgtttatgtcagcaacattgagctgcgaccac
cgggtcattgacggtgccattggtgcagaatggatgaaggcgttcaagggctacatcgag
aatccaacgaccatgttgctgtaa

DBGET integrated database retrieval system