KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340126Help
Entry
4340126           CDS       T01015                                 

Definition
Os06g0147800
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:osa04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 352 aa AA seqDB search
MGKPGKLALPSHESTIGKFLTQSGTFKDGDLLVNKDGLRIVSQSEEGEAPPIEPLDHNQL
SLDDLDAIKVIGKGSSGIVQLVRHKWTGQFFALKVIQLNIQENIRRQIAQELKISLSTQC
QYVVACCQCFYVNGVISIVLEYMDSGSLSDFLKTVKTIPEPYLAAICKQVLKGLMYLHHE
KHIIHRDLKPSNILINHMGEVKISDFGVSAIIASSSAQRDTFTGTYNYMAPERISGQKHG
YMSDIWSLGLVMLELATGEFPYPPRESFYELLEAVVDHPPPSAPSDQFSEEFCSFVSACI
QKNASDRSSAQILLNHPFLSMYDDLNIDLASYFTTDGSPLATFNTSNRYDDR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggggaagccggggaagctagcgctgccctcgcacgagtcaaccatcggcaaattcctg
acgcagagcgggacgttcaaggacggcgatctgctcgtcaacaaggacggcctccgcatc
gtctcgcagagcgaggaaggggaggcccctcctatagaacctttagatcataatcagttg
agtctagatgatctagacgcaatcaaagttatcggtaaaggtagtagtggaatcgtgcag
ttggttcgccacaaatggactggccagttttttgctctgaaggtaatacaactcaatatc
caggagaatatacgcagacagattgcgcaggaattgaaaatcagcttgtcaacacagtgc
caatatgttgttgcatgctgtcagtgtttttacgttaatggtgtcatttcaattgttttg
gagtatatggacagtggctctctctcagatttcctgaagacagttaaaaccattccagag
ccctaccttgctgcaatctgtaagcaggtgctaaaaggactgatgtacttacatcatgag
aagcacatcatacaccgagatctgaagccgtcaaatatattaataaatcatatgggtgaa
gtaaaaatatccgactttggtgttagtgccatcattgctagttcctcggcacaacgagat
acatttactgggacatataactacatggcgccagaaagaatcagtgggcaaaaacatggt
tatatgagtgatatctggagcttgggcctcgttatgctagaattggccactggtgaattt
ccatatcctcctcgtgaaagcttttatgaactccttgaagctgttgtcgaccacccacca
ccttctgctccatcagaccagttttcagaggaattctgttcattcgtctctgcatgtatc
caaaagaatgcttcggataggtcatctgcacaaatcttattaaatcatccattcctgagc
atgtatgacgacctgaatatagatcttgcttcgtacttcacaaccgatggatctccgctt
gccaccttcaatacaagcaaccgatatgatgacagatag

DBGET integrated database retrieval system