KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340155Help
Entry
4340155           CDS       T01015                                 

Definition
Os06g0152100
Orthology
K05759  
profilin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4340155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 131 aa AA seqDB search
MSWQAYVDDHLMCEIDGNHLTAAAIVGHDGSVWAQSPNFPQYKPEEITGIMKDFDEPGSL
APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGICVKKTGLSLILGIYDEPMTPGQCNMIVE
RLGDYLIEQGC
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaggcgtacgtcgacgaccacctgatgtgcgagattgacggcaaccacctc
accgccgccgccatcgtcggccacgacggcagcgtctgggcgcagtcccccaacttcccg
cagtacaagcctgaggagattactggcatcatgaaggactttgatgaacccggcagtctc
gcaccaactggtcttttccttgggggcacaaaatacatggtgatccaaggtgaaccaggg
gttgtcatccgaggaaagaagggcactggaggcatatgtgtcaagaagactggcctgtcg
ttgattcttggaatctatgatgagccgatgaccccaggccagtgcaacatgattgtggag
aggcttggcgattatctgatcgagcagggttgctaa

DBGET integrated database retrieval system