KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340170Help
Entry
4340170           CDS       T01015                                 

Definition
Os06g0154500
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:osa00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    4340170
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     4340170
Protein kinases [BR:osa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   4340170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 398 aa AA seqDB search
MDAGAQPPDTEMAEAGGGQQPPAAAAAAGAGAGAGMMENIQATLSHGGRFIQYNIFGNVF
EVTAKYKPPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRH
MDHENIVAIRDIIPPPQRNSFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRG
LKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARTTSETDFMTEYVVTRWYRAPELLL
NSSEYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPNEADLDFVNENAR
RYIRQLPRHARQSFPEKFPHVHPLAIDLVEKMLTFDPRQRITVEGALAHPYLASLHDISD
EPVCSSPFSFDFEQHALSEEQMKDLIYQEGLAFNPDYQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggacgccggggcgcagccgccggacacggagatggcggaggccggcggcgggcagcag
ccgcctgctgcggctgcggcggcgggggcgggggcaggggcggggatgatggagaacatc
caggcgacgctgagccatggcgggaggttcatccagtacaacatcttcgggaacgtgttc
gaggtcaccgccaagtacaagccccccatcctccccatcggcaagggcgcctacggcatc
gtctgctcggcgctcaactcggagacgggggagcaggtggcgatcaagaagatcgccaac
gcgttcgacaacaagatcgacgccaagcgcacgctcagggagatcaagctgctccgccac
atggaccacgagaatattgttgccataagggatatcatacctcctccacaaaggaattca
ttcaatgacgtttatattgcatatgaattgatggatactgatctgcatcaaattattcgc
tcaaatcaagcattgtcagaggagcactgccagtatttcctttatcagattctccgtggc
ttgaagtatatacattcagcaaatgtccttcaccgagacttgaagcccagcaacctactt
ttgaatgcaaattgtgacctcaaaatttgtgattttggacttgctcgtaccacctcagaa
accgattttatgactgagtatgttgtcacaagatggtatagggcaccggaacttctgttg
aattcctctgaatatactgcagcaattgatgtgtggtctgtgggctgtatttttatggaa
ctcatggatcgtaaacctttgtttcctggaagagatcatgtccatcaattacgtctacta
atggagctcatcggaacgccaaatgaggctgatctggattttgtaaatgaaaatgcaaga
agatacattcgccaacttcctagacatgcaaggcagtcctttcctgaaaaatttccacat
gttcatcctttagcaattgatctggttgaaaagatgctgacatttgatcctagacagaga
ataacagttgaaggtgcccttgcacatccttacctggcatcactgcatgacataagtgat
gagccagtctgctcatcacccttcagctttgacttcgagcagcatgcattgtccgaggaa
caaatgaaggatctaatctaccaagaaggccttgcgttcaaccctgattaccagtag

DBGET integrated database retrieval system