KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340223Help
Entry
4340223           CDS       T01015                                 

Definition
(RefSeq) protein disulfide isomerase-like 1-5
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4340223
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4340223
Chaperones and folding catalysts [BR:osa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   4340223
Membrane trafficking [BR:osa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    4340223
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4340223
  Exosomal proteins of colorectal cancer cells
   4340223
  Exosomal proteins of bladder cancer cells
   4340223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Thioredoxin_7 Thioredoxin_2 Calsequestrin Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 4340223
NCBI-ProteinID: XP_015642967
UniProt: Q5WA72
Position
6
AA seq 533 aa AA seqDB search
MRARRVVAAAAVLLLFAVVAVARLDLDDDGDDSEVLDELLAVDEEEERGELGGGGEAAAA
EAVRRAQSMVLVLDNDNARRAVEENAEVLLLGYAPWCERSAQLMPRFAEAAAALRAMGSA
VAFAKLDGERYPKAASAVGVKGFPTVLLFVNGTEHQFTGLHTKDAIVTWVRKKTGAPASR
IQSKDSAEEFLKKDQTFAVGLFKNFEGAEYEEFVKAATSENEVQFVETNDRNVAKILFPG
IASEEQFLGLVKSEPEKFEKFNGAFEEKEIIQFVELNKFPLITVFTDLNSGKVYGSPIKL
QVFTFAEAYDFEDLESMIQEVARGFKTKIMLIYVDTAEEKLAKPFLTLYGLEPEKPTVTA
FDTSKGTKYLMEAEINAKNLQDFCLSLLEGTLPPYFRSEPVPEEKGPIEKVVGRTFDSSV
LESPQNVFLEVHAPWCVDCEAISKNVEKLAKHFNDLGQTNLKFARIDASVNEHPKLQINN
YPTLLLYPAQDKSNPIKLSKKSNLKDMAKFVKEKLQIADVETVAAGDIVKDEL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgcggagggttgtcgcggcggcggcggtgctgctgctgttcgccgttgtggcg
gtggcgcggctcgacctggacgacgacggggacgactcggaggtgctggacgagctgctc
gcggtggacgaggaggaggagagaggggagctcggtggaggaggggaggcggcggcggcg
gaggcggtgcggcgggcgcagtcgatggtgctggtgctcgacaacgacaacgcgcggcgc
gccgtggaggagaacgcggaggtgctcctgctgggctacgcgccgtggtgcgagcgcagc
gcgcagctcatgccgcggttcgccgaggccgccgcggcgctgcgcgccatggggagcgcc
gtcgcgttcgccaagctcgacggggagaggtaccccaaggccgcctccgccgtcggggtc
aaggggttccccaccgtcctcctcttcgtcaacggcaccgagcaccaattcactggcctc
cacaccaaggacgcgatagttacttgggtaagaaagaagactggtgcaccagctagtagg
attcagtcaaaggattccgctgaggaatttctgaaaaaggatcaaacttttgctgttggt
cttttcaaaaattttgagggagcagaatatgaagaattcgtgaaagcagcaacctcagaa
aatgaagtgcaatttgtcgaaaccaatgataggaatgtggccaaaattctttttcctggt
attgcatctgaagagcaattcctgggccttgtgaaaagcgagccagaaaagtttgagaag
ttcaacggggcatttgaagaaaaggagataattcaatttgtggagcttaacaagttccca
cttattactgtattcactgatctcaactctggtaaagtttatgggagccctattaagcta
caggtcttcacctttgcagaggcttatgatttcgaagatcttgaatctatgatccaagag
gttgccagaggattcaaaacaaagataatgcttatatatgtggatactgctgaagaaaag
cttgctaaaccattcctgactctctatggactcgaaccagaaaaacctactgtgacagca
tttgataccagcaaaggtaccaaatatctgatggaggcagaaattaacgcgaagaaccta
caggacttctgcttaagccttctggagggtacacttccgccatacttccgatcagaacca
gtaccagaagaaaagggacctattgaaaaggttgttggccgtacatttgattcttcagtt
ctagaaagtcctcaaaatgtgttccttgaggttcatgcaccttggtgtgttgactgtgag
gccataagtaaaaacgtggagaagttggccaaacatttcaatgatttgggccagactaat
cttaaatttgcacgcatagatgcttctgtgaatgaacatcccaaattgcagataaacaac
taccctacactgttgctatatcctgcccaagacaaaagcaacccgataaaactttcaaag
aaatcaaatctgaaggacatggcaaaattcgtcaaggagaagctgcaaattgcggatgtc
gaaacagtagccgctggtgacattgtcaaggatgagctatag

DBGET integrated database retrieval system