KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340223Help
Entry
4340223           CDS       T01015                                 

Definition
Os06g0163400
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:osa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 533 aa AA seqDB search
MRARRVVAAAAVLLLFAVVAVARLDLDDDGDDSEVLDELLAVDEEEERGELGGGGEAAAA
EAVRRAQSMVLVLDNDNARRAVEENAEVLLLGYAPWCERSAQLMPRFAEAAAALRAMGSA
VAFAKLDGERYPKAASAVGVKGFPTVLLFVNGTEHQFTGLHTKDAIVTWVRKKTGAPASR
IQSKDSAEEFLKKDQTFAVGLFKNFEGAEYEEFVKAATSENEVQFVETNDRNVAKILFPG
IASEEQFLGLVKSEPEKFEKFNGAFEEKEIIQFVELNKFPLITVFTDLNSGKVYGSPIKL
QVFTFAEAYDFEDLESMIQEVARGFKTKIMLIYVDTAEEKLAKPFLTLYGLEPEKPTVTA
FDTSKGTKYLMEAEINAKNLQDFCLSLLEGTLPPYFRSEPVPEEKGPIEKVVGRTFDSSV
LESPQNVFLEVHAPWCVDCEAISKNVEKLAKHFNDLGQTNLKFARIDASVNEHPKLQINN
YPTLLLYPAQDKSNPIKLSKKSNLKDMAKFVKEKLQIADVETVAAGDIVKDEL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgcggagggttgtcgcggcggcggcggtgctgctgctgttcgccgttgtggcg
gtggcgcggctcgacctggacgacgacggggacgactcggaggtgctggacgagctgctc
gcggtggacgaggaggaggagagaggggagctcggtggaggaggggaggcggcggcggcg
gaggcggtgcggcgggcgcagtcgatggtgctggtgctcgacaacgacaacgcgcggcgc
gccgtggaggagaacgcggaggtgctcctgctgggctacgcgccgtggtgcgagcgcagc
gcgcagctcatgccgcggttcgccgaggccgccgcggcgctgcgcgccatggggagcgcc
gtcgcgttcgccaagctcgacggggagaggtaccccaaggccgcctccgccgtcggggtc
aaggggttccccaccgtcctcctcttcgtcaacggcaccgagcaccaattcactggcctc
cacaccaaggacgcgatagttacttgggtaagaaagaagactggtgcaccagctagtagg
attcagtcaaaggattccgctgaggaatttctgaaaaaggatcaaacttttgctgttggt
cttttcaaaaattttgagggagcagaatatgaagaattcgtgaaagcagcaacctcagaa
aatgaagtgcaatttgtcgaaaccaatgataggaatgtggccaaaattctttttcctggt
attgcatctgaagagcaattcctgggccttgtgaaaagcgagccagaaaagtttgagaag
ttcaacggggcatttgaagaaaaggagataattcaatttgtggagcttaacaagttccca
cttattactgtattcactgatctcaactctggtaaagtttatgggagccctattaagcta
caggtcttcacctttgcagaggcttatgatttcgaagatcttgaatctatgatccaagag
gttgccagaggattcaaaacaaagataatgcttatatatgtggatactgctgaagaaaag
cttgctaaaccattcctgactctctatggactcgaaccagaaaaacctactgtgacagca
tttgataccagcaaaggtaccaaatatctgatggaggcagaaattaacgcgaagaaccta
caggacttctgcttaagccttctggagggtacacttccgccatacttccgatcagaacca
gtaccagaagaaaagggacctattgaaaaggttgttggccgtacatttgattcttcagtt
ctagaaagtcctcaaaatgtgttccttgaggttcatgcaccttggtgtgttgactgtgag
gccataagtaaaaacgtggagaagttggccaaacatttcaatgatttgggccagactaat
cttaaatttgcacgcatagatgcttctgtgaatgaacatcccaaattgcagataaacaac
taccctacactgttgctatatcctgcccaagacaaaagcaacccgataaaactttcaaag
aaatcaaatctgaaggacatggcaaaattcgtcaaggagaagctgcaaattgcggatgtc
gaaacagtagccgctggtgacattgtcaaggatgagctatag

DBGET integrated database retrieval system