KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340341Help
Entry
4340341           CDS       T01015                                 

Definition
Os06g0185900
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:osa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:osa00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 67 aa AA seqDB search
QGVDVNGPNTAPIYKFLKSSAGGFLGDLVKWNFEKFLVDKTGKVVERYPPTTSPFQIEKD
IQKLLAA
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
caaggtgttgatgtcaacgggcctaacacagcccctatttataagtttcttaagtcgagt
gctggaggatttttgggtgatcttgtgaaatggaattttgagaagttcttggtggacaaa
actggaaaagttgttgagagatacccacctacaacttcaccattccagattgagaaggac
atccagaaactccttgcggcataa

DBGET integrated database retrieval system