KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340706Help
Entry
4340706           CDS       T01015                                 

Definition
Os06g0265000
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:osa00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 591 aa AA seqDB search
MCGILAVLGVADVSLAKRSRIIELSRRLRHRGPDWSGIHCYQDCYLAHQRLAIVDPTSGD
QPLYNEDKSVVVTVNGEIYNHEELKANLKSHKFQTASDCEVIAHLYEEYGEEFVDMLDGM
FAFVLLDTRDKSFIAARDAIGICPLYMGWGLDGSVWFSSEMKALSDDCERFISFPPGHLY
SSKTGGLRRWYNPPWFSESIPSTPYNPLLLRQSFEKAIIKRLMTDVPFGVLLSGGLDSSL
VASVVSRHLAEAKVAAQWGNKLHTFCIGLKGSPDLRAAKEVADYLGTVHHELHFTVQEGI
DALEEVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKMVLSGEGSDEIFGGYLYFHKAPN
KKEFHEETCRKIKALHLYDCLRANKSTSAWGVEARVPFLDKNFINVAMDIDPEWKMIKRD
LGRIEKWVLRNAFDDEEKPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANEHVSDSMMMN
ASFVYPENTPVTKEAYYYRTIFEKFFPKNAARLTVPGGPSVACSTAKAVEWDAAWSKNLD
PSGRAALGVHDAAYEDTLQKSPASANPVLDNGFGPALGESMVKTVASATAV
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatcctcgccgtgctcggcgtcgcagacgtctccctcgccaagcgctcccgc
atcatcgagctatcccgccggttacgtcatagaggccctgattggagtggtatacactgc
tatcaggattgctatcttgcacaccagcggttggctattgttgatcccacatccggagac
cagccgttgtacaatgaggacaaatctgttgttgtgacggtgaatggagagatctataac
catgaagaattgaaagctaacctgaaatctcataaattccaaactgctagcgattgtgaa
gttattgctcatctgtatgaggaatatggggaggaatttgtggatatgttggatgggatg
ttcgcttttgttcttcttgacacacgtgataaaagcttcattgcagcccgtgatgctatt
ggcatttgtcctttatacatgggctggggtcttgatggttcggtttggttttcgtcagag
atgaaggcattaagtgatgattgcgagcgattcatatccttcccccctgggcacttgtac
tccagcaaaacaggtggcctaaggagatggtacaacccaccatggttttctgaaagcatt
ccctccaccccgtacaatcctcttcttctccgacagagctttgagaaggctattattaag
aggctaatgacagatgtgccatttggtgttctcttgtctggtggactggactcttctttg
gttgcatctgttgtttcgcggcacttggcagaggcaaaagttgccgcacagtggggaaac
aaactgcatacattttgcattggtttgaaaggttctcctgatcttagagctgctaaggaa
gttgcagactaccttggtactgttcatcacgaactccacttcacagtgcaggaaggcatt
gatgcactggaggaagtcatttaccatgttgagacatatgatgtaacgacaattagagca
agcaccccaatgttcttgatgtcacgtaaaattaaatctttgggggtgaagatggttctt
tcgggagaaggttctgatgaaatatttggcggttacctttattttcacaaggcaccaaac
aagaaggaattccatgaggaaacatgtcggaagataaaagcccttcatttatatgattgc
ttgagagcgaacaaatcaacttctgcatggggtgttgaggcccgtgttccgttccttgac
aaaaacttcatcaatgtagctatggacattgatcctgaatggaaaatgataaaacgtgat
cttggccgtattgagaaatgggttctccggaatgcatttgatgatgaggagaagccctat
ttacctaagcacattctatacaggcaaaaggagcaattcagtgatggtgttgggtacagt
tggattgatggattgaaggatcatgcaaatgaacatgtatcagattccatgatgatgaac
gctagctttgtttacccagaaaacactccagttacaaaagaagcgtactattataggaca
atattcgagaaattctttcccaagaatgctgctaggttgacagtacctggaggtcctagc
gtcgcgtgcagcactgctaaagctgttgaatgggacgcagcctggtccaaaaaccttgat
ccatctggtcgtgctgctcttggtgttcatgatgctgcatatgaagatactctacaaaaa
tctcctgcctctgccaatcctgtcttggataacggctttggtccagcccttggggaaagc
atggtcaaaaccgttgcttcagccactgccgtttaa

DBGET integrated database retrieval system