KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341352Help
Entry
4341352           CDS       T01015                                 

Definition
Os06g0571100
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 352 aa AA seqDB search
MASSAPSAAAGATPPDPLRRDRILSSKLYLDVPGSKAPVVYSPAYDIAFLGIEKLHPFDS
SKWGRICKFLTKEGHLEKNRVVEPLEATKDDLLVVHSESYLNSLKSSLKVASIVELPPVA
FIPNWLVQQKLLYPFRKQVGGSILSAKLALERGWAINVGGGFHHCSAEQGGGFCAYADIS
LCIQFAFVRLNISRVMIIDLDAHQGNGHEKDFANDGRVYTLDMYNAGIYPYDHVAKRYID
QKVELVSGTKTEDYLDQLDKALKVAESRFQPQLIVYNAGTDILDGDPLGRLKISPQGVVI
RDEKVFRFAKDQSIPLLMLTSGGYMKSSARVIADSIINLSNKNLIELGSQLG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttccgcgccgtccgcggcggcgggggcgaccccgccggaccccctccgccgc
gaccgcatcctctccagcaagctctacctcgacgtcccgggctccaaggctccggtggtg
tactcgccggcgtacgacatcgccttcctcgggatcgagaagctgcacccgttcgattcc
tccaaatggggccgcatatgcaagttcctcaccaaggaagggcacctggagaagaaccga
gtggtggagccattggaagcgaccaaggacgatttgctggtggtgcactcggagtcgtac
ttgaacagcctcaagagcagcctgaaggttgcgtccattgtagagcttcctcctgtggca
ttcattcctaattggcttgtgcagcaaaagctactgtaccctttcaggaaacaggtgggt
gggtcgattctatcggccaagcttgcacttgagagaggatgggccattaatgttggcgga
gggtttcaccattgttcggcagagcaagggggcgggttttgtgcatatgctgatatttct
ctctgcattcagtttgcttttgtccgtctaaatatttcaagagtgatgatcatagatctg
gatgcccaccaaggaaatggccatgaaaaggatttcgctaatgatggaagagtttacact
ttggatatgtacaatgctggaatatatccctatgatcatgttgctaagcggtatattgat
caaaaagtcgagctagttagtgggacaaagacagaagactacttggatcaacttgacaag
gctcttaaggttgcagaaagtagatttcagcctcagttgattgtttacaatgctgggaca
gatatcctggatggcgatccattgggaagattgaagataagccctcagggcgtggtgatc
agagatgagaaggtgttcaggtttgcaaaggatcaaagcatcccactactcatgttaaca
tcaggaggatacatgaagtcgagcgcccgagtgatcgccgactcgataatcaatctctcg
aataaaaacttgatagagcttggtagccagcttggctga

DBGET integrated database retrieval system