KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341553Help
Entry
4341553           CDS       T01015                                 

Definition
Os06g0622500
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4341553
Protein phosphatases and associated proteins [BR:osa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4341553
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     4341553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 724 aa AA seqDB search
MVDRVHGSLRLFMHRNAVFLCERLCAQFPAETNVQLLATCYLHNNQPYAAYHILKGFFNT
FPKYKECMFQVVQQGTTFLEYTGRVEAAAEQFVQALTLDPLLWAAYEELCILGVAEDANE
CFSEATALRLQQELTSTSNVEKSNFVNENRFLSSNVSASFGDSPKQIKQLHANTTAEVSG
YPHVKSTALHMQNGAPSNLSQFDTPSPTSTQASGIAPPPLFRNMHAYQNTAGGNAPSKPK
VNAPNLTLRRKYIDEAGLKKVSGRLFNQSSDSVPRRSARLSRDTTINSNSNISQFGGNGT
DHSSGNRYHVVDEMWTDNVTSTSSSTSIVDGRYPEQEKSERVLSQDSKLAIGIRELMALL
RTLGEGYRLSCLFKCQEALEVYRKLPEAQFNTGWVLCQVGKTYFELVNYLEADHFFELAH
RLSPCTLEGMDIYSTVLYHLNEEMRLSYLAQDLVSIDRLSPQAWCAVGNCFALRKDHETA
LKNFQRAVQLDSRVAYAHTLCGHEYSALEDYENSIKLYRSALQVDERHYNAWYGLGVVYL
RQEKFEFAEHHFRRAFQINPCSSVLMCYLGMALHALKRNEEALEMMENAIFADKKNPLPK
YQKALILLGLQKYPDALDELERLKEIAPHESSMYALMGKIYKQLNILDKAVFCFGIALDL
KPPAADVAIIKSKEMEKAQGWIASVSQLCSTLKGQSNHHDGGRLAIIAHEVRQKALSSTK
QLAI
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggtggaccgcgtccacggcagcctccgcctcttcatgcaccgcaacgccgtcttcctc
tgcgagcgcctctgcgcccagttccccgccgagacaaatgtccagttgctagcgacttgc
taccttcacaacaaccagccatatgctgcataccacatcttgaaaggcttcttcaatact
tttccaaaatataaggaatgcatgttccaagtggtgcaacagggcactaccttcttggag
tacactggcagagtggaagctgcagctgagcaatttgtacaagctctgactcttgatcct
cttctatgggcagcatacgaggaattgtgcatactaggtgttgctgaagatgcaaatgaa
tgtttcagtgaagcaacagctctacgtcttcagcaggaactcacatccacatcaaatgtg
gaaaagtcaaactttgttaatgaaaatcggtttctatcttccaatgtgtcagcaagtttt
ggtgatagtcctaagcaaattaaacagctgcatgctaacaccactgcagaagtatctggt
tatcctcatgtaaagtcaactgcattgcatatgcagaacggtgcaccatctaatttatca
cagtttgacactccatcgccaacttcaacgcaggcttctggcattgctccaccaccactc
tttcggaatatgcatgcttatcagaatacagcaggtggcaatgctccttccaaaccaaag
gttaatgctccgaacctgacactccgaagaaaatacatcgatgaagcaggcctaaagaag
gtttctggaaggctgtttaatcagagtagtgattcagttcctcgaagaagtgcaagactt
tctagagatacaacaataaactcaaactcaaatatctctcaatttggagggaatggaaca
gatcactcgtcaggaaacaggtaccacgttgttgatgaaatgtggacagataatgtaact
tcaacttcgtcttctacaagtatagttgatggaagatatcccgagcaagagaaatctgaa
cgagttctgtcacaggactccaaattagctattggtatcagggagctaatggcactcttg
cggacactaggggaagggtataggctttcttgcttgtttaagtgtcaggaagcattggaa
gtatatagaaagctcccagaggcacaatttaatactggatgggttctttgccaggttggg
aagacatattttgaactcgtcaattatttagaagccgatcatttttttgagttagcgcat
cgactatcaccatgcacgttggagggaatggacatttactccactgttctttatcatttg
aatgaggaaatgcggctaagttaccttgctcaagatcttgtttctattgatcgactatct
ccccaagcatggtgtgctgtgggaaattgctttgccttgaggaaagatcatgagactgcc
ttgaagaattttcaacgtgctgtacagcttgactcaagagttgcatacgctcacacgcta
tgcggtcacgagtattctgcattggaggattatgagaacagtataaaactataccgctct
gcacttcaggtagatgaaagacactacaatgcctggtatggccttggagtggtgtacctt
cgccaggaaaagtttgagtttgctgagcatcatttcagaagggcattccagataaatcct
tgctcttctgttcttatgtgctatcttgggatggccttgcatgctttaaagaggaatgag
gaagccttggaaatgatggagaacgctatatttgctgataagaagaatccactccccaag
tatcaaaaggctttaatccttctaggcctacaaaaataccctgatgctctggatgagttg
gaacggctaaaggaaattgcacctcatgaaagtagtatgtatgcactgatgggaaagatt
tacaagcaacttaacattcttgacaaggctgtattttgctttggcattgccctggatttg
aaacctcctgctgctgacgttgctataatcaagtcaaaagaaatggagaaggcacaagga
tggattgcttcagtgagtcagctttgttccactctaaaaggccagagcaatcatcacgat
ggcggccggctcgcaattattgctcatgaagtcaggcagaaagcgttgtcgtcgacaaaa
caattagcgatctaa

DBGET integrated database retrieval system