KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341553Help
Entry
4341553           CDS       T01015                                 

Definition
(RefSeq) cell division cycle protein 27 homolog B isoform X1
  KO
K03350  
anaphase-promoting complex subunit 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4341553
Protein phosphatases and associated proteins [BR:osa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4341553
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     4341553
Chromosome [BR:osa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    4341553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
6
AA seq 761 aa AA seqDB search
METLMVDRVHGSLRLFMHRNAVFLCERLCAQFPAETNVQLLATCYLHNNQPYAAYHILKG
KKLPESRYLFAMSCFRMNLLREAEEALCPVNEPNIEVPSGATGHYLLGVIYRYTGRVEAA
AEQFVQALTLDPLLWAAYEELCILGVAEDANECFSEATALRLQQELTSTSNVEKSNFVNE
NRFLSSNVSASFGDSPKQIKQLHANTTAEVSGYPHVKSTALHMQNGAPSNLSQFDTPSPT
STQASGIAPPPLFRNMHAYQNTAGGNAPSKPKVNAPNLTLRRKYIDEAGLKKVSGRLFNQ
SSDSVPRRSARLSRDTTINSNSNISQFGGNGTDHSSGKLRVNSSTPSKLCSTALRSVQVR
KGKPQATENFDEGNRYHVVDEMWTDNVTSTSSSTSIVDGRYPEQEKSERVLSQDSKLAIG
IRELMALLRTLGEGYRLSCLFKCQEALEVYRKLPEAQFNTGWVLCQVGKTYFELVNYLEA
DHFFELAHRLSPCTLEGMDIYSTVLYHLNEEMRLSYLAQDLVSIDRLSPQAWCAVGNCFA
LRKDHETALKNFQRAVQLDSRVAYAHTLCGHEYSALEDYENSIKLYRSALQVDERHYNAW
YGLGVVYLRQEKFEFAEHHFRRAFQINPCSSVLMCYLGMALHALKRNEEALEMMENAIFA
DKKNPLPKYQKALILLGLQKYPDALDELERLKEIAPHESSMYALMGKIYKQLNILDKAVF
CFGIALDLKPPAADVAIIKSAMEKVHLPDELMDDDDDDDEI
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccctaatggtggaccgcgtccacggcagcctccgcctcttcatgcaccgcaac
gccgtcttcctctgcgagcgcctctgcgcccagttccccgccgagacaaatgtccagttg
ctagcgacttgctaccttcacaacaaccagccatatgctgcataccacatcttgaaagga
aagaagctgccagagtcccggtacttgtttgctatgtcatgcttccgaatgaacctctta
cgggaagctgaagaagccttgtgtcctgtcaatgaaccaaatattgaggttccaagtggt
gcaacagggcactaccttcttggagtaatttacaggtacactggcagagtggaagctgca
gctgagcaatttgtacaagctctgactcttgatcctcttctatgggcagcatacgaggaa
ttgtgcatactaggtgttgctgaagatgcaaatgaatgtttcagtgaagcaacagctcta
cgtcttcagcaggaactcacatccacatcaaatgtggaaaagtcaaactttgttaatgaa
aatcggtttctatcttccaatgtgtcagcaagttttggtgatagtcctaagcaaattaaa
cagctgcatgctaacaccactgcagaagtatctggttatcctcatgtaaagtcaactgca
ttgcatatgcagaacggtgcaccatctaatttatcacagtttgacactccatcgccaact
tcaacgcaggcttctggcattgctccaccaccactctttcggaatatgcatgcttatcag
aatacagcaggtggcaatgctccttccaaaccaaaggttaatgctccgaacctgacactc
cgaagaaaatacatcgatgaagcaggcctaaagaaggtttctggaaggctgtttaatcag
agtagtgattcagttcctcgaagaagtgcaagactttctagagatacaacaataaactca
aactcaaatatctctcaatttggagggaatggaacagatcactcgtcaggtaaattgcga
gtaaactcgtccacaccatcaaaattgtgttcaacagctctacgttccgtgcaagttagg
aaagggaaaccacaggcaacagaaaattttgatgaaggaaacaggtaccacgttgttgat
gaaatgtggacagataatgtaacttcaacttcgtcttctacaagtatagttgatggaaga
tatcccgagcaagagaaatctgaacgagttctgtcacaggactccaaattagctattggt
atcagggagctaatggcactcttgcggacactaggggaagggtataggctttcttgcttg
tttaagtgtcaggaagcattggaagtatatagaaagctcccagaggcacaatttaatact
ggatgggttctttgccaggttgggaagacatattttgaactcgtcaattatttagaagcc
gatcatttttttgagttagcgcatcgactatcaccatgcacgttggagggaatggacatt
tactccactgttctttatcatttgaatgaggaaatgcggctaagttaccttgctcaagat
cttgtttctattgatcgactatctccccaagcatggtgtgctgtgggaaattgctttgcc
ttgaggaaagatcatgagactgccttgaagaattttcaacgtgctgtacagcttgactca
agagttgcatacgctcacacgctatgcggtcacgagtattctgcattggaggattatgag
aacagtataaaactataccgctctgcacttcaggtagatgaaagacactacaatgcctgg
tatggccttggagtggtgtaccttcgccaggaaaagtttgagtttgctgagcatcatttc
agaagggcattccagataaatccttgctcttctgttcttatgtgctatcttgggatggcc
ttgcatgctttaaagaggaatgaggaagccttggaaatgatggagaacgctatatttgct
gataagaagaatccactccccaagtatcaaaaggctttaatccttctaggcctacaaaaa
taccctgatgctctggatgagttggaacggctaaaggaaattgcacctcatgaaagtagt
atgtatgcactgatgggaaagatttacaagcaacttaacattcttgacaaggctgtattt
tgctttggcattgccctggatttgaaacctcctgctgctgacgttgctataatcaagtct
gcaatggagaaagtacaccttccagatgaacttatggatgatgatgatgatgatgatgag
atttaa

DBGET integrated database retrieval system