KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341640Help
Entry
4341640           CDS       T01015                                 

Gene name
P0017B12.1
Definition
(RefSeq) formamidopyrimidine-DNA glycosylase
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    4341640 (P0017B12.1)
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     4341640 (P0017B12.1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     4341640 (P0017B12.1)
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4341640 (P0017B12.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 400 aa AA seqDB search
MPELPEVEAARRALEAHCVGRRIARCAVADDPKVVVAAAGGRVAFERAMVGRTIVAARRR
GKNLWLRLDAPPFPSFQFGMAGAIYIKGVPVTKYKRSVVSSTDEWPSKYSKFFVQLDDGL
EFSFTDKRRFARVRLFEDPETVPPISELGPDALFEPMSSDSFADSLSRKKIGIKALLLDQ
SFISGIGNWIADEVLYQSRTHPLQIASSLSRESCEALHQSIQEVVKYAVEVDADCDCFPV
EWLFHHRWGKKPGKVNGQKIEFITAGGRTTAYVPQLQKLTGMQSSKVVIANPEQVAENDD
AKEIDTDPEDADNLNTKKRGATSRVARGKQKRDAIGALSRKTRKNGGGKEKPGSDYSEDD
GETAEPNKVSTSSKGEKADPVRRSSRTASKPRQVNKLKER
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctgccggaggtggaggcggcgaggagggcgctggaggcgcactgcgtgggg
aggaggatcgcgcgctgcgcggtggcggatgaccccaaggtggtggtcgccgccgccggg
gggcgcgtggcgttcgagcgcgccatggtcggccggaccatcgtcgccgcgcggcggagg
ggcaagaacctctggctccgcctcgacgcccctccattcccctccttccagttcgggatg
gcaggtgcgatctacattaagggagttcctgtgaccaagtacaagagatcagttgtcagt
tctacagacgagtggccctccaagtactccaaattttttgttcaacttgatgatggctta
gagttttccttcactgataagaggcggtttgcaagagttcggttgtttgaagatcccgaa
actgtacccccgatttctgagttaggaccagatgctctctttgagccgatgtcttctgac
agttttgcggactcgctgagcagaaagaagattggaataaaagctcttctactcgatcag
agcttcatatcaggaattggtaattggattgcagatgaggtgctttaccagtcgagaacc
catccattacagattgcttcaagtctatccagggagagttgtgaagcactacaccaaagc
atccaagaggttgtgaaatatgctgttgaagttgatgctgattgtgactgctttcctgtg
gaatggttattccatcaccgatggggcaagaagcctggtaaagtcaatggacagaaaatt
gagttcataacagctggtggcaggactacagcatacgtgccacaactgcagaagctgact
ggaatgcaatctagcaaagtagtcattgctaacccagaacaagtggcagagaacgatgat
gcgaaggaaatagacacagatccagaagatgctgataatttgaatacaaagaagcgagga
gcaacttctagggttgccaggggaaagcaaaagagagatgccataggtgccctttccaga
aagacaaggaaaaatggtggtggcaaggagaaaccaggtagtgactatagtgaagatgat
ggtgagactgctgaaccaaacaaagttagcaccagtagcaagggcgagaaggcagatccg
gtgagaagatcatcaaggaccgcatcgaaaccccgccaggtaaataaattaaaagaaaga
tag

DBGET integrated database retrieval system