KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341708Help
Entry
4341708           CDS       T01015                                 

Gene name
P0709F06.7
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 15
  KO
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4341708 (P0709F06.7)
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   4341708 (P0709F06.7)
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    4341708 (P0709F06.7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1069 aa AA seqDB search
MLGGGLGGGGGGGGAGGLGLDLSAVIQAAVVGLVLFSAAVVAVRRAASRYFVVDAAGFAA
SSYDDHHHPHHHLVMTPRGEEQQRQQGGGAAQGAQAAASGGGEPCAACGYIATKKCSGCK
RVRYCSQGCQSKHWQSGHKFKCKQMKKSSPADKLSGGGEEDRNKLSGFGPISLVPARRKL
NKVIFPYDEFLKLCNWRDLDYLPCGLLNCGNSCFANVVLQCLSCTRPLAAYLLGMDHSRE
CYKRHEDWCFLCELQCHIQRASESMHPFAPKNILSHLPNIGGNLGFGRQEDAHEFMRFAI
DKMQSACLDEFGGEKAVDPSTQETTLIQHIFGGRLQSQVQCTACGMVSNRYENMMDLTVE
IHGDADSLEECLDKFTAVEWLDGDNKYKCDGCSDYVKAQKRLTVYQAPNILTITLKRFQS
GRFGKLNKRVTFPMKLDLTPYMSSTDGSDQYDLYAVVVHLDMLNASFFGHYICYIKNYRG
RWYKIDDCKVMAVDEEEVHAQGAYMLLYSRRTARPRPLIAVEELMKQQQQLKVCPLNGQN
HLIQEDVPLEGVPSLKPSEDLEVDFESNNKSLHTMDREPDLDFHVSFDRDKFTNNDIMHP
PVSTVSHALDENTRGDSGFPLEESNTMGSVQFGNSTYETSLVHSPAEQCEEPASCIDSVD
YMEIDTEAGVKVERWSRPALGDSVGVMGNGTLVPALENGLAGKPIPGFPDKPSRINSFFA
EGCQTGDNGAGSSQELNGHCNGEPSCPEQGVLTNGGNTPSPSTQCYENKFATSTNGNYSI
GNGDTLSSSNSLHAGKQNAGFTYNGFNPKPYKEPSGSNTYLNNTCNGKPSEDNHNKCAPN
LPAKDCQGGMPFLHRGFLLRPCSRGNPGKCDDGLSISNGTSSSFVSSNSKSSNISSSRNG
EGGTPFLSPSFRTNHCRESAAMDTSASSVHDLKTSYNISLEQKSIGAAVPSDLIKESWGE
DGTTFGTVYQQRATSVDNVSSRHDENGHVILGANNSSYGGENGSNNGILDMNSSSSQRDA
ASSTMMASEKGIGPKTADQVNYISDALEHDGLRRRLTSNFPDQNGIDAQ
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgctggggggaggcctcggcggcggcgggggcggcggcggtgcgggtgggctgggcctc
gacctctcggcggtgatccaggcggcggtggtcggcctcgtgctgttctcggcggccgtc
gtcgccgtgcgccgcgccgcgtcgaggtacttcgtcgtcgacgccgcggggttcgccgcc
tcctcgtacgacgatcaccaccacccccaccaccacctcgtgatgacgcctcgcggggag
gagcagcagcggcagcagggcggcggcgcggcgcagggggcgcaagccgccgccagtggg
ggcggggagccctgtgccgcgtgcggctacatcgccaccaaaaagtgctccgggtgcaag
cgcgtgcggtattgttctcaaggatgtcagtcaaagcattggcaatctggtcacaagttc
aagtgcaaacaaatgaaaaaatcaagccctgctgacaagctatcaggtggaggcgaggaa
gacagaaataagttatctggttttggtcccatctcattagtacctgcccgtagaaaatta
aacaaggtcatctttccatatgatgaatttctaaagctgtgcaactggagggaccttgat
tatttaccttgtggccttttgaattgtggcaacagttgctttgccaatgttgttttacaa
tgtctttcatgtacgaggccacttgcagcctatctcttaggaatggaccatagcagggaa
tgttataagagacatgaagattggtgtttcttgtgcgaactgcaatgccatatccaaagg
gcaagtgaaagtatgcatccatttgcgccgaagaacattctttctcacctgccaaatata
ggtgggaaccttggctttggtagacaagaggatgctcatgaattcatgaggtttgcaata
gataagatgcaatctgcttgtcttgatgaatttggaggcgagaaggctgtagaccctagc
acgcaagaaacgactcttattcaacacatatttggtggtcgtctgcaatcccaggttcaa
tgtactgcatgtggaatggtctcaaatcgctatgagaatatgatggacttaacagttgaa
attcatggtgatgctgactccttggaagaatgcttagataagttcactgcagtagagtgg
cttgatggtgataataagtacaaatgtgatggatgcagcgactatgtcaaagcacagaaa
cgtcttacagtttatcaagctccaaatatcctcacaattactctgaaaagattccagagt
ggtagatttgggaaactaaacaagagagttacattcccaatgaagttagacctaacgcca
tacatgagtagcactgatggaagtgaccaatacgatctctatgctgttgttgttcatctg
gatatgctcaatgcttcattttttgggcattatatatgctatataaaaaattaccgagga
cgctggtataaaattgatgactgcaaggttatggctgttgatgaggaggaagtacatgct
caaggtgcttatatgcttctatatagcaggagaacagctcgccctaggccactaattgca
gtagaagaactcatgaaacagcagcaacagttgaaagtatgccctttgaatggacaaaat
catttgatacaagaggatgtgccattagaaggcgtgccatctttgaaaccctcagaagat
ctggaagttgattttgaatccaacaacaaatctttacatactatggacagagagccagac
ctggattttcatgtgagctttgatagagataagttcactaacaatgatattatgcaccca
ccagtttcaacggtatcgcatgcccttgatgaaaatactagaggagattcaggttttcca
ttggaagaatcgaacaccatgggatctgtgcaatttggcaactccacatatgaaacatct
ttagtgcattcccctgcagagcagtgtgaagaacctgcgtcatgtattgattcagttgac
tacatggaaattgacactgaagctggcgttaaagttgaaagatggagcaggcctgcctta
ggtgattcagttggagtgatggggaatggtacattggtcccggcattggagaatggtttg
gcgggtaaaccaattcctggttttcccgacaaaccctcgagaataaattcattctttgca
gaaggatgtcaaactggtgacaatggtgctggttcctcgcaagagttgaatggtcattgc
aatggagaacccagttgcccagagcaaggagttctgaccaatggtggcaacacgccctct
ccaagcacacaatgctatgaaaataagtttgcaacatccaccaacggcaactattctatt
gggaatggtgatacattatctagcagcaactcattacatgcgggcaaacagaatgctggc
tttacctataatggtttcaatccaaaaccttacaaagaaccatcaggaagcaacacatat
ctgaataatacatgcaatggtaaaccatcggaagataatcacaataaatgtgccccaaac
ctgccggcaaaagattgccaagggggcatgccattcttacatcgtggcttccttctaagg
ccttgttctaggggaaatccaggcaaatgtgatgatggcttgtcaattagtaatggcaca
tcatcatcctttgtgagtagtaacagcaaatcaagtaatatttcatcatctcgaaatggt
gaaggaggcacaccattcttgtctcctagttttcgcacaaatcattgcagagagtcagct
gccatggacacctctgcaagctctgtccatgatttgaaaaccagctataacatttccttg
gagcaaaaatctattggtgctgcagtaccgtcagacctgataaaagaaagttggggtgaa
gatggcacgacttttggcactgtttaccaacaaagagcaacttctgttgataatgtaagc
agccgccatgatgaaaatgggcatgtgattttgggtgccaataattccagttatggagga
gaaaacggcagtaataatggaattcttgatatgaatagcagcagtagccaaagggacgca
gcatctagtaccatgatggcttctgagaaaggcataggacctaaaacagctgaccaagtc
aattacatatctgatgcacttgaacatgatggtttgcgacgaagattaacctcaaatttt
cctgatcagaatggtattgatgctcaataa

DBGET integrated database retrieval system