KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341956Help
Entry
4341956           CDS       T01015                                 

Gene name
MAP2, MPK4, OsMAP2, OsMSRMK3, msrmk3
Definition
(RefSeq) mitogen-activated protein kinase 4
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:osa00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    4341956 (MAP2)
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     4341956 (MAP2)
Protein kinases [BR:osa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   4341956 (MAP2)
Chromosome [BR:osa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     4341956 (MAP2)
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4341956 (MAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
6
AA seq 369 aa AA seqDB search
MAMMVDPPNGMGNQGKHYYTMWQTLFEIDTKYVPIKPIGRGAYGIVCSSINRATNEKVAI
KKINNVFDNRVDALRTLRELKLLRHLRHENVIALKDIMMPVHRRSFKDVYLVYELMDTDL
HQIIKSSQPLSNDHCQYFLFQLLRGLKYLHSAGILHRDLKPGNLLVNANCDLKICDFGLA
RTNNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIVNVLGTMSEADIEFIDNPKARKYIKTLPYTPGIPLTSMYPQAHPLAIDLLQKML
VFDPSKRISVTEALEHPYMSPLYDPSANPPAQVPIDLDIDENLGVDMIREMMWQEMLHYH
PEVVAGVNM
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgatggtggaccctcctaatggcatgggaaaccaagggaagcattactacaca
atgtggcaaacgctatttgagattgacaccaagtatgtgccaatcaagcccatcggaaga
ggggcttatggaatagtttgctcctctataaaccgtgcaaccaacgaaaaagttgcaata
aagaagatcaacaatgtctttgacaaccgtgtggatgcactgaggaccctaagggagctg
aaactactgcgacacttgcgccatgaaaatgttattgccttgaaagatataatgatgcca
gtacacagaaggagtttcaaagatgtatacttggtttatgaactcatggacacagatcta
caccagataattaaatcatctcaacctctttctaatgaccactgtcaatatttccttttt
cagctactccgaggtctgaagtacctccattcagcagggatactccatcgagacctgaaa
ccagggaacctcctggttaatgcaaactgcgatctgaagatctgcgactttggtttggct
cgcacaaacaacactaaaggccagtttatgactgaatatgtcgtgacccggtggtatagg
gctcctgagctgctgctctgctgcgacaattacggaacctccatagatgtctggtctgtt
ggctgcatctttgctgagcttcttggccgcaagccaatatttccaggaactgagtgcctc
aatcagctcaagctcatagtcaacgttctcggcaccatgagtgaagctgacattgagttc
attgacaacccaaaggcccgcaagtatatcaagacccttccatacactcctggcatcccc
ctcaccagtatgtacccgcaagcacatcctcttgccattgatctgttgcagaagatgctc
gtctttgatccctccaaaaggattagtgtcactgaagctctggagcacccttacatgtct
ccactgtatgatccaagcgcaaaccctcctgctcaagtgcccatcgatctcgacatcgat
gaaaatcttggcgtggatatgatccgggagatgatgtggcaggagatgctccactatcac
ccagaggttgttgcaggagtgaatatgtga

DBGET integrated database retrieval system