KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341956Help
Entry
4341956           CDS       T01015                                 

Definition
Os06g0699400
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 369 aa AA seqDB search
MAMMVDPPNGMGNQGKHYYTMWQTLFEIDTKYVPIKPIGRGAYGIVCSSINRATNEKVAI
KKINNVFDNRVDALRTLRELKLLRHLRHENVIALKDIMMPVHRRSFKDVYLVYELMDTDL
HQIIKSSQPLSNDHCQYFLFQLLRGLKYLHSAGILHRDLKPGNLLVNANCDLKICDFGLA
RTNNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIVNVLGTMSEADIEFIDNPKARKYIKTLPYTPGIPLTSMYPQAHPLAIDLLQKML
VFDPSKRISVTEALEHPYMSPLYDPSANPPAQVPIDLDIDENLGVDMIREMMWQEMLHYH
PEVVAGVNM
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgatggtggaccctcctaatggcatgggaaaccaagggaagcattactacaca
atgtggcaaacgctatttgagattgacaccaagtatgtgccaatcaagcccatcggaaga
ggggcttatggaatagtttgctcctctataaaccgtgcaaccaacgaaaaagttgcaata
aagaagatcaacaatgtctttgacaaccgtgtggatgcactgaggaccctaagggagctg
aaactactgcgacacttgcgccatgaaaatgttattgccttgaaagatataatgatgcca
gtacacagaaggagtttcaaagatgtatacttggtttatgaactcatggacacagatcta
caccagataattaaatcatctcaacctctttctaatgaccactgtcaatatttccttttt
cagctactccgaggtctgaagtacctccattcagcagggatactccatcgagacctgaaa
ccagggaacctcctggttaatgcaaactgcgatctgaagatctgcgactttggtttggct
cgcacaaacaacactaaaggccagtttatgactgaatatgtcgtgacccggtggtatagg
gctcctgagctgctgctctgctgcgacaattacggaacctccatagatgtctggtctgtt
ggctgcatctttgctgagcttcttggccgcaagccaatatttccaggaactgagtgcctc
aatcagctcaagctcatagtcaacgttctcggcaccatgagtgaagctgacattgagttc
attgacaacccaaaggcccgcaagtatatcaagacccttccatacactcctggcatcccc
ctcaccagtatgtacccgcaagcacatcctcttgccattgatctgttgcagaagatgctc
gtctttgatccctccaaaaggattagtgtcactgaagctctggagcacccttacatgtct
ccactgtatgatccaagcgcaaaccctcctgctcaagtgcccatcgatctcgacatcgat
gaaaatcttggcgtggatatgatccgggagatgatgtggcaggagatgctccactatcac
ccagaggttgttgcaggagtgaatatgtga

DBGET integrated database retrieval system