KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341999Help
Entry
4341999           CDS       T01015                                 

Definition
Os06g0704800
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 54 aa AA seqDB search
FFFWIQIGYLEYYKQRGFTSCYIWACPPVKGEDYILYCHPEIQKTPKSDKLRQW
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
ttttttttctggatacagataggttatcttgagtactataagcagcgtggattcaccagt
tgttatatatgggcttgccctcctgttaaaggtgaagattacattttgtattgccatcca
gagattcagaagacaccaaagtctgataaactgcgtcagtggtaa

DBGET integrated database retrieval system