KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342117Help
Entry
4342117           CDS       T01015                                 

Definition
Os06g0726400
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:osa00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
6
AA seq 820 aa AA seqDB search
MLCLTSSSSSAPAPLLPSLADRPSPGIAGGGGNVRLSVVSSPRRSWPGKVKTNFSVPATA
RKNKTMVTVVEEVDHLPIYDLDPKLEEFKDHFNYRIKRYLDQKCLIEKHEGGLEEFSKGY
LKFGINTVDGATIYREWAPAAQEAQLIGEFNNWNGAKHKMEKDKFGIWSIKISHVNGKPA
IPHNSKVKFRFRHGGGAWVDRIPAWIRYATFDASKFGAPYDGVHWDPPACERYVFKHPRP
PKPDAPRIYEAHVGMSGEEPEVSTYREFADNVLPRIRANNYNTVQLMAIMEHSYYASFGY
HVTNFFAVSSRSGTPEDLKYLVDKAHSLGLRVLMDVVHSHASNNVTDGLNGYDVGQNTHE
SYFHTGDRGYHKLWDSRLFNYANWEVLRFLLSNLRYWMDEFMFDGFRFDGVTSMLYHHHG
INKGFTGNYKEYFSLDTDVDAIVYMMLANHLMHKLLPEATIVAEDVSGMPVLCRPVDEGG
VGFDFRLAMAIPDRWIDYLKNKEDRKWSMSEIVQTLTNRRYTEKCIAYAESHDQSIVGDK
TIAFLLMDKEMYTGMSDLQPASPTINRGIALQKMIHFITMALGGDGYLNFMGNEFGHPEW
IDFPREGNNWSYDKCRRQWSLVDTDHLRYKYMNAFDQAMNALEEEFSFLSSSKQIVSDMN
EKDKVIVFERGDLVFVFNFHPNKTYKGYKVGCDLPGKYRVALDSDALVFGGHGRVGHDVD
HFTSPEGMPGVPETNFNNRPNSFKVLSPPRTCVAYYRVDEDREELRRGGAVASGKIVTEY
IDVEATSGETISGGWKGSEKDDCGKKGMKFVFRSSDEDCK
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgtctcacctcctcttcctcctccgcgcccgctccgctccttccctctctcgct
gatcgaccgagcccgggaatcgcgggcgggggtggcaatgttcgcctgagcgtggtttct
tcgccgcgccggtcgtggcctggaaaggtcaagaccaatttctcagttcctgcgactgcg
cgaaaaaacaaaaccatggtgactgttgtggaggaggtcgaccaccttcctatatatgat
ctggaccctaagttggaggaattcaaggatcacttcaactataggataaaaagatacctc
gaccagaaatgcctgattgaaaaacatgaggggggccttgaagaattttctaaaggctat
ttgaagtttgggattaatacagttgatggtgccacaatatatcgtgaatgggcgcctgct
gcacaagaagcacagctcattggtgagttcaataactggaatggtgcaaaacacaagatg
gagaaggataaatttggcatttggtcaatcaagatttcacatgtcaatgggaagcctgcc
atccctcacaattccaaggttaaatttcgctttaggcatgggggtggagcatgggttgat
cgtattcccgcatggattcgttatgcaacttttgatgcctctaaatttggagctccatat
gatggtgtacactgggatcctccagcctgtgaaaggtacgtgtttaagcatcctcgacct
ccaaaacctgatgctccacgcatctatgaggctcatgtggggatgagtggtgaagagcca
gaagtaagcacatacagagaatttgcagacaatgtgttaccacgcatacgggcaaataac
tacaacacagttcagttaatggcaatcatggaacattcctactatgcttcttttgggtat
cacgtgacaaattttttcgcagtcagcagcagatcaggaacaccagaggatctgaaatat
cttgttgacaaggcacatagtttaggattacgagttctgatggatgttgtccatagccat
gcgagtaataatgtgaccgatggtctaaatggctatgacgttggacaaaacactcatgag
tcttattttcatacaggagataggggctaccataaactctgggatagtcgtctgttcaac
tatgccaattgggaggtcttaagatttcttctttctaatttgagatattggatggacgaa
ttcatgtttgatggcttccgatttgatggggttacatcaatgctataccatcaccatggt
atcaataagggatttactggaaactacaaggagtatttcagtttggataccgatgtggat
gcaattgtttacatgatgctcgcaaaccatttaatgcataaactcttgccggaagcaact
attgttgctgaagatgtttcgggcatgccagtgctttgtcggccagttgatgaaggtgga
gtagggtttgacttccgcctggcaatggccattcctgatagatggattgactacctgaag
aacaaagaggaccgcaaatggtcaatgagtgaaatagtgcaaactttgactaacaggaga
tatacagaaaaatgcattgcctatgccgagagccatgatcagtccattgttggtgacaag
actatagcatttctcttgatggacaaggaaatgtacactggcatgtcagacttgcagcct
gcttcacctaccatcaaccgtggcattgcactccaaaagatgattcacttcattacgatg
gcccttggaggtgatggctacttaaattttatgggcaatgagtttggccatccagaatgg
attgactttccaagagaaggcaacaactggagctatgataaatgcagacgtcagtggagc
cttgtcgacactgatcaccttcgatacaagtatatgaatgcatttgatcaagcaatgaat
gcactcgaggaggaattttccttcctgtcatcatcaaagcagattgttagcgacatgaac
gagaaagataaggttattgtctttgaacgtggagatttggtttttgttttcaattttcat
cccaacaaaacttacaagggttacaaagtcggatgtgacttgcccgggaagtacagagta
gctctggactctgatgctttggtctttggtggccatggaagagttggccatgatgtggat
cacttcacgtctcccgagggaatgccaggagtaccagaaacaaatttcaacaaccgccct
aactcattcaaagtcctttccccgccccgtacctgtgtggcttactatcgcgttgatgaa
gatcgtgaagagctcaggaggggtggagcagttgcttctggaaagattgttacagagtat
atcgatgttgaagcaacaagtggggagactatctctggtggctggaagggctccgagaag
gacgattgtggcaagaaagggatgaagtttgtgtttcggtcttctgacgaagactgcaaa
tga

DBGET integrated database retrieval system