KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342210Help
Entry
4342210           CDS       T01015                                 

Definition
Os07g0108300
Orthology
K14272  
glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44 2.6.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Alanine, aspartate and glutamate metabolism
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4342210
   01210 2-Oxocarboxylic acid metabolism
    4342210
   01230 Biosynthesis of amino acids
    4342210
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4342210
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4342210
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4342210
   00260 Glycine, serine and threonine metabolism
    4342210
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     4342210
    2.6.1.4  glycine transaminase
     4342210
    2.6.1.44  alanine---glyoxylate transaminase
     4342210
    2.6.1.-  
     4342210
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4342210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 485 aa AA seqDB search
MFGGGGGGGRKPLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ
KPLTFPRQVVALCQAPFLLDDPNVGLIFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIR
KEVAEFIERRDGYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSAAIS
LFGGSLVPYYLEEEANWGLDFVNLRQTVASARSKGITVRAMVIINPGNPTGQCLSEGNIK
ELLKFCFHENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREVQLVSFHTVSKGY
WGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKFS
AESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDAAKRAGKAAD
VFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDTFMDQYD
GYSRM
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcggcggcggcggcggcgggaggaagccgctggactacgaggagctgaacgag
aacgtgaagaaggtgcagtacgcggtgcggggggagctgtacctgcgcgcctccgagctc
cagaaggagggcaagaagatcatcttcaccaacgtcggcaacccacacgcgctcggccag
aagccgctcaccttcccccgccaggttgtggcgctgtgccaggcccccttcctgctcgat
gatcccaacgtcggccttatcttccccgccgacgccatcgcgcgggccaagcactacctc
gccatggcacccggtggactaggtgcttacagtgattcccgaggtatccctggtattagg
aaggaagtcgccgagttcatcgagaggcgtgatggttatccaagtgatccagaacttatt
tacctcacagatggtgccagcaaaggtgtgatgcaaatgctgaataccattatcagaaat
gagagagatgggattctggttcctgttccacaatacccgctttattctgctgccatttcc
ctctttggtggttctctcgtgccatactacttagaagaagaggctaactggggacttgac
ttcgtcaatctccgacagactgtggcgtcagcgcggtcaaagggaatcactgttcgagca
atggtgattatcaacccaggaaaccctactggccaatgccttagtgaaggaaacataaag
gaacttctcaaattctgcttccatgagaacttagttctgcttgcagatgaagtctatcaa
cagaacatttatcaagatgagcgcccatttataagtgctagaaaggttctgtttgacatg
ggtcctcctatgagcagggaagttcagctggtttctttccatactgtgtcaaaaggatat
tggggggagtgtggacaacgtggagggtattttgaaatgacaaatcttcctcccaagaca
gtagacgagatctacaaggttgcatcaatcgcactcagtccaaatgttcctgggcagatc
tttatgggtttaatggttaaccctcctaagcctggagatatctcttatctgaagttttct
gctgaaagcaagtctatcctcgagtctttgaggaggagagcacgcctgatgacagatggt
ttcaatagttgccgaaatgttgtctgcaatttcacagaaggagctatgtactctttcccc
caaatacgcttaccaccaaaagctatagatgcagccaaaagggctggcaaagcggccgat
gttttctactgcctcaagcttcttgaagcaactggaatatccactgttccagggtcaggt
ttcggacaaaaagaaggggtgttccacctgaggacgaccatcctgccagctgaggaggac
atgcctgccatcatgaccagcttcaagaagttcaacgacactttcatggatcagtacgat
ggctactccaggatgtga

DBGET integrated database retrieval system