KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342448Help
Entry
4342448           CDS       T01015                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 8 isoform X1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
7
AA seq 885 aa AA seqDB search
MATAATAQASASSSTASTRGSPAASSSSHSAVCLVPFRWWARVREEAPPEGGVRYAATAA
ASPSSYYGLRLLHSFLHPDLVLRLERGGCRGTGAGAGGRSYALVPADELSRVLARQNSSL
ALHNKHSFAEDSAGAYPLVLRISVRETSILTVKISKKDNPVENYKRAYKIFNIDSQPVHV
WDFSGQTNLILMNEWNRSNHDCCHSELENILEVQVYAMSDSLTSKIGGTSKEYTEQSSAD
VNDMDVDLSYGSFGRSSSHGLIGLENLGNTCFMNSSIQCLAHTSKLVDYFLGDYDRDINR
TNPLGLNGELALAFGELLRRLWNTERKPVSPHHFKAKIACFAPQFSGFNQHDSQELLAFL
LDGLHEDLNQVKCKPYEEAKDASGRPDKEVADEYWSNHLARNDSVIVDTYHGQYKSTLTC
PTCSKTSVTFDPFMYLSLPVPSTAKRTMTVTVFSTDGSIEPISYDVTVPQFGSLNDLVQA
LSSACSLGDDEILLITEVYNNRILRYLEEPSDSVSLLRDGDKLAAFRLPRKYEKSPVVVF
THQYFDERSSIDNITPQMKEFEAPLLAVLPERANGLTLKNIYLKLLEPLRFSKSTSSLND
SGRCNSGCAAVMMDATPDSDSKFQSAPSENAPESSQSETIECQMTEGPSESNIGDTTDSD
REAHMEEFEFYLINGRGEFQQTRIQTDEVDLQTTPNRLLINVHWQQNAVGQYDTSMLKSL
PEIHKLELIPKGNEDSVALHGCLEAFLKEEPLGPEDMWYCPCCKKHQQAMKKLDLWRLPE
VLVIHLKRFSYTQFTRNKLETFVDFPISDLDLSSYIIDKSELSDCHYRLYAISNHYGNMG
GGHYTASIYHEEGKGWYKFDDECVRPITEDSIKTPAAYVLFYRRE
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgccaccgcccaggcctccgcctcctcctccaccgcctccacccgcggc
tcccccgccgcctcctcctcctcccactccgccgtctgcctcgtccccttcaggtggtgg
gcgagggtgagggaggaggcgccgccggaaggcggggtgaggtacgcggcgaccgcggcg
gcgtcgccctcgtcgtactacgggcttcgcttgctccacagcttcctccacccggatctc
gtgcttcgcctcgagcgcgggggttgccgcggcacgggtgccggcgccggggggcggagc
tacgcgctcgtgccggccgacgagctctcgcgtgtgctcgcgaggcaaaattctagtttg
gcattgcataataaacattcatttgctgaggatagtgctggtgcgtaccctttggtgctt
aggatatctgttcgagaaacaagcattttgactgtgaagatcagcaaaaaggacaatcca
gttgagaactataaacgggcatacaagatttttaatattgattctcaaccagttcatgtt
tgggatttttcaggccagacaaacctaatattaatgaatgagtggaataggtcaaatcat
gactgctgccactcagagctagagaatattcttgaagtgcaagtctatgcaatgtctgac
tccttaacttccaagattggtggaaccagcaaagagtatacagaacaatcttctgcagat
gttaatgatatggatgttgatttgtcctatggaagctttggaagatctagctcgcatggg
ctaattggattggaaaatcttgggaatacttgctttatgaacagttcaattcaatgtttg
gcccacacatcaaagcttgttgattatttcctaggagattatgacagggatataaatcgg
actaacccactaggactgaatggggaacttgctttggcatttggagaattattgaggaga
ttatggaacaccgagagaaaaccagtttcaccacatcactttaaggcaaagattgcttgt
tttgcccctcagttcagtggcttcaatcagcatgattcacaggagcttcttgctttctta
ttggatggcctccatgaagatcttaaccaggtcaagtgcaagccatatgaagaagctaag
gatgcaagtgggcgccctgacaaagaagtggctgatgagtactggagtaatcatttagct
cgaaatgactctgtaatagttgatacttaccatgggcagtacaaatctacattaacttgc
cctacttgcagtaaaacatctgtcacttttgacccatttatgtacttgtctttgcctgta
ccttccacggcaaagaggacaatgactgttacagttttcagcactgatggtagtatagag
ccaatctcatatgatgtcactgtgccacaatttgggagtcttaatgatcttgttcaggct
ttaagttctgcttgttcactgggagatgatgaaatcctgctgattacagaggtttataac
aaccgcatcctccgatacctcgaagagccttcagattcagtttcattgctgagggatgga
gataaattggcagcattccggctaccaagaaaatatgaaaaatccccagttgtggttttt
acacaccaatattttgatgagcgttctagtattgataatataacaccacaaatgaaggaa
tttgaggccccactgctggcagttcttcctgagagagccaatggattaactctgaagaat
atctacctgaagttgttggaaccattaagattttccaagagtactagttctcttaatgat
agtgggaggtgtaatagtggctgtgctgctgtcatgatggatgcaacgcctgattcagat
agtaagtttcagagtgctccatcggaaaacgcccctgaaagtagccagtctgagactatt
gaatgccaaatgaccgaaggacctagtgagtcaaatattggtgacactactgattctgat
cgggaggcacacatggaagagtttgaattttatttaataaatggaaggggtgaattccag
cagacgagaatacaaacagatgaggtggatttacagacaacaccaaaccggctacttatc
aatgtccattggcaacaaaatgcagtaggacaatatgacacctcaatgctgaaaagtcta
cctgagattcataagcttgagcttatcccgaaaggaaatgaagattctgtcgcactacat
ggttgtctggaagcctttctaaaagaggaaccgttgggcccagaagacatgtggtactgc
ccatgctgcaaaaagcatcaacaagcgatgaagaaattagatctgtggaggctaccggaa
gttcttgtcattcatctcaaaaggttctcgtacacccaattcacaagaaataagcttgag
acatttgtggatttccccattagtgatttggatctgtcatcatatatcattgacaagagt
gaactatcagactgccactatcgcttgtatgctattagcaatcactatggaaatatggga
ggtggacactacaccgccagcatctaccatgaagaagggaagggatggtataagtttgat
gatgagtgcgtgagacctataactgaagacagtataaagacacctgctgcttatgtgctg
ttctacagacgagaatga

DBGET integrated database retrieval system