KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342469Help
Entry
4342469           CDS       T01015                                 

Definition
Os07g0163800
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     4342469
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   4342469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 157 aa AA seqDB search
SKAFTYDEVVEKVAQKLGVDDPTKIRLTSHNCYSQQPKPQPIKYRGVERLLDMLIHYNQT
SDILYYEVLDIPLPELQALKTLKVTYHHGTKDEVSVHSIRLPKNSTVGDVLNDIKSKVYF
CTPYLWCVFHILQLFYLLVLQSLTYALCVPSAITKPG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
tcgaaggctttcacgtatgatgaagtagtggaaaaggtggctcaaaaacttggtgttgat
gacccaactaaaattcggcttacatcgcataactgttattctcaacaacctaaacctcaa
cctattaaatacagaggtgttgagcgtttgctggacatgctgattcactataaccagact
tctgatattctttactatgaagtattggatataccactcccagaattacaagctctgaag
acattaaaagttacatatcatcatggcacaaaagatgaggtgtcagttcacagtattagg
ttgccaaagaacagcactgtcggtgatgtgctaaatgatataaaatcaaaggtatatttt
tgtaccccttatttatggtgtgtattccacattctccagttattctatttgttggtttta
caaagtttaacttatgccctatgtgtgccttcggctattaccaaaccaggttga

DBGET integrated database retrieval system