KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343003Help
Entry
4343003           CDS       T01015                                 

Definition
Os07g0410100
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4343003
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4343003
   00020 Citrate cycle (TCA cycle)
    4343003
   00620 Pyruvate metabolism
    4343003
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     4343003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 541 aa AA seqDB search
MSAAHLLRHSRKLRSLHNALDCERSGLVRYFSTASGSFPTKGNGAEKRIGGARFPQRKQP
GKELETSKLSLGLNGSYTCRRSPNNFIPNTITGLNGSLSCGQIASARSFSSSADLPPHQE
IGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDG
SKEIKVGEIIAVTVEEEGDIKKFKDYKPSTLAAPVAPSELKAQSEPTEPKVEEREPSKAS
ELKAPRTEEPSRSGDRIFSSPLARKLAEDNNVPLSSVKGTGPDGRILKADIEDYLAKGCR
KEALAAPGLSYTDVPNAQIRKVTANRLLSSKQTIPHYYLTVDTRVDNLIKLRGELNPLQE
SSGGKKISINDLVIKAAALALRKVPQCNSSWMNDFIRQYHNVNINVAVQTEHGLFVPVIR
DADKKGLGMIAEEVKQLAQRARDNSLKPDDYEGGTFTISNLGGPFGIKQFCAIINPPQSA
ILAIGSAERRVIPGSANGQYEFGSFMSATMSCDHRVIDGAIGAEFLKAFKGYIENPTSML
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcgcatctcctccgccactctcgcaagttgcggagtttacacaatgctcta
gactgtgagcgttctggcctcgtgcgctacttctccactgcttctggttcgttccccacc
aagggaaatggtgctgagaaaagaattggaggtgccagatttcctcagcgcaagcaacct
ggaaaagagcttgagacctccaagttgtcactaggacttaatggaagctacacttgcagg
agatcacctaacaactttatcccaaatactattactggtctcaatggttcattgtcatgt
ggacagatagcttcagcaagatctttctcaagcagtgcagacctgccaccacatcaggaa
atagggatgccatcactctctcctacaatgaccgaggggaacattgcaaggtggctgaag
aaggaaggagataaggtctcacctggtgaagttctttgtgaggtggagactgataaagcc
accgtagaaatggagtgcatggaagagggctatcttgctaagatcattcatggagatggt
tccaaagagatcaaagttggtgagattattgctgtaaccgtggaagaagagggtgacatc
aagaagtttaaggattataaaccttcaactttggctgcacctgtagccccttctgaactg
aaggctcagtctgagcctacagaaccaaaggtggaggaaagagagccttccaaagcatct
gagctaaaggccccaaggactgaagaaccttcgcggtcaggagatcgaatattctccagc
cctcttgctagaaaattggcggaagataacaatgttccactgtcgagtgtaaagggaact
ggtcctgatgggcgcattttgaaggcagacattgaagattacttggctaagggttgcaga
aaggaagctcttgcggctccagggctaagttacaccgatgttcccaatgcacaaataaga
aaggttactgcgaaccgcctgctaagctctaagcaaacaattccacattattacctgaca
gttgacacacgtgttgataatctcatcaagttgcgaggggaactgaatccattgcaggag
tcctccggtggtaagaagatatctattaatgatctagttataaaggctgcagctctggct
cttcgaaaggtccctcagtgtaatagctcctggatgaatgattttatccgccaataccac
aacgtgaacatcaatgttgctgtacagactgagcatggactgtttgttccagtaatcagg
gatgcagacaagaaaggacttggtatgattgcggaggaggtgaagcagttggctcaaaga
gcaagggataacagtttgaaaccagatgattatgagggaggcacattcaccatatcaaac
ttgggaggtccttttggaattaagcaattttgtgccatcataaatcctcctcagtcggca
atcttggccattggttctgctgagaggagggtgatacctggcagcgccaatggtcaatac
gagtttggttccttcatgtcggcaacaatgagctgtgatcacagggttattgatggtgca
atcggggcagaatttctgaaagcattcaagggctatatcgagaatccaacctcaatgtta
ctgtga

DBGET integrated database retrieval system