KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343441Help
Entry
4343441           CDS       T01015                                 

Definition
Os07g0529000
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4343441
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4343441
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     4343441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 572 aa AA seqDB search
MSSPFSVPSLIMEEEGRFEAEVAEVEAWWGTDRFRLTKRPYTARDVALLRGTLRQSYASG
DMAKKLWRTLRAHQANGTASRTFGALDPVQVAMMAKHLDTVYVSGWQCSSTHTSTNEPGP
DLADYPYDTVPNKVEHLFFAQLYHDRKQREARMSMSRAERAHEPYVDYLKPIIADGDTGF
GGATATVKLCKLFVERGAAGVHLEDQSSVTKKCGHMAGKVLVAVSEHVNRLVAARLQFDI
MGVETVLVARTDAVAATLIQTNVDARDHQFILGATNPRLRNRSLAAVLSDAMSAGKNGRE
LQAIEDEWLATAQLKTFSDCVRDAIASLNATDADKQRKLQEWSAATSHDKCVPLEQARDI
AAGLGVTSLFWDWDLPRTREGFYRFRGSVAAAVVRGRAFAPHADVLWMETSSPNIAECTA
FAEGVRAASPGAMLAYNLSPSFNWDASGMTDADMSEFIPRVARLGYVWQFITLAGFHADA
LVTDTFARDFARRGMLAYVERIQREERSNGVETLQHQKWSGANFYDRVLKTVQGGISSTA
AMGKGVTEEQFKGSWTGPGSESSSHVLAKSRM
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgccgttctccgtgccatctctgatcatggaggaggaagggcggttcgaggcg
gaggtggcggaggtggaggcgtggtggggaacggacaggttccggctcaccaagcgcccc
tacacggcgcgcgacgtcgcgctcctccgcggcacgctccggcagagctacgcctccggc
gacatggccaagaagctgtggcgcacgctcagggcgcaccaggccaacggcacggcgtcg
cgcaccttcggcgcgctcgaccccgtccaggtcgccatgatggcgaagcacctcgacacc
gtctacgtctccggatggcagtgctcgtcgacgcacacctcgacgaacgagccgggcccc
gacctcgccgactacccctacgacaccgtccccaacaaggtcgagcacctcttcttcgcc
cagctctaccacgaccgcaagcagcgggaggcgcgcatgtcgatgtccagggcggagcgc
gcgcacgagccgtacgtggattatcttaagcccatcatcgccgacggcgacaccgggttc
ggcggcgccacggccaccgtcaagctgtgcaagctgttcgtcgagcgcggggcggccggg
gttcacctcgaggaccagtcgtcggtgaccaagaagtgcgggcacatggcggggaaggtg
ctcgtcgccgtctccgagcatgtcaaccgcctcgtcgccgcgcggctccagttcgacatc
atgggcgtcgagaccgtcctcgtcgcgcgcaccgacgccgtcgccgccacgctgatccag
accaacgtcgacgcgcgcgaccaccagttcatcctcggcgcgaccaacccgcgcctcagg
aaccggagcctcgccgccgtcctctccgacgccatgtcggcgggcaagaacggcagggag
ctccaggccatcgaggacgagtggctcgccacggcgcagctcaagaccttctctgactgc
gtcagggacgccatcgcgagcctcaacgccaccgacgccgacaagcagcgcaagctccag
gagtggagcgccgccaccagccacgacaagtgcgtgcccctcgagcaggcgcgcgacatc
gccgcgggcctcggcgtcacatccctgttctgggactgggacctgccgagaacacgggag
gggttctaccgcttccgcggctccgtcgcggcggccgtcgtccgcggccgcgcgttcgcg
ccgcacgccgacgtgctctggatggagacgtcgagccccaacatcgccgagtgcacggcg
ttcgccgagggcgtgagggcggcgagcccgggcgcgatgctggcgtacaacctctcgccg
tccttcaactgggacgcctccggcatgacggacgccgacatgtcggagttcatcccgcgc
gtggcgaggctggggtacgtgtggcagttcatcacgctcgccgggttccacgccgacgcg
ctcgtcacggacacgttcgcccgcgacttcgcgcggcgcggcatgctggcgtacgtggag
aggatccagagggaggagaggagcaacggcgtggagacgctgcagcaccagaagtggtcg
ggcgccaacttctacgacagggtgctcaagaccgtgcagggtggcatctcctctaccgcc
gccatgggcaaaggagttactgaagagcagttcaagggctcatggacagggcctggaagt
gagagcagcagccatgttcttgccaaatccaggatgtga

DBGET integrated database retrieval system