KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343581Help
Entry
4343581           CDS       T01015                                 

Definition
Os07g0558200
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    4343581
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     4343581
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    4343581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 431 aa AA seqDB search
MPLLHLSPPPHRLLLAGGGRRRLLLPAARRRSLVRVRAAASAAAAAAEAYGLPFPPERAA
HHRELAAAAAAVERACRLCVDVKRTLLSGDKKILEKNDQTPVTVADFGVQALISLELQRL
FPSIPLVAEEDSASLRSSNTDDNSSNVLVESISSAVAEKVSNANSLLTHDDVLRAIDRGG
KNAVSFDSNPASYWVLDPIDGTKGFLGGDDALYVVGLALVVNEKVVAGVMGCPNWSNATI
ASRKEDSAAAQPDHGILMIAHVGCGTWSRHLSVDIGQFTTAQSTWNRCLVDSCSVVNMAR
FCIPDSQTWNMIPLSVLFNSTMDESNPRDENEILLLSVYCGSLCKYLTVASGRASVFVLR
ARTKNLKSWDHAVGVICVQEAGGQISDWSGKPLDLAADLTGRRDIYPSGGVLVTNGALHG
KLVEMISANHK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcctccacctctcgccgccgccgcaccgcctcctcctcgccggcggcggccgc
cgccgcctactcctcccggcggctcgccgccgctccctcgtccgcgtcagggcggcggcg
tcggcggccgcggccgcggcggaggcgtacgggctacccttccctcctgagcgcgccgcc
caccaccgggagctcgcggcggccgccgcggccgtcgagcgcgcctgccgcctctgcgta
gacgtgaagagaacgctgctttcgggtgacaagaagattcttgaaaagaatgaccaaact
cctgtcacagttgcagattttggagtacaagctcttattagtttagagctccagcgattg
tttccgtcaatacctctggtggcagaagaggattcagcttctctgaggtcatccaatact
gatgataacagtagtaatgttcttgttgagtcaatttcaagtgctgttgcagaaaaagtg
agtaacgccaattcacttttaactcatgatgatgtgctgagagctattgatagaggaggc
aagaatgctgtatcctttgattcaaatcctgctagttattgggtacttgatccaattgat
ggcacaaaaggtttcttgggaggggacgatgctctgtatgtggtggggctggctcttgtg
gtaaatgaaaaggtagtagcaggagtgatgggatgtcctaattggtctaatgctaccata
gccagcagaaaagaagacagcgctgctgcccaacctgatcatgggatccttatgattgct
catgtgggctgtggaacttggtctaggcatttgtctgtcgatattggccagttcactacg
gcacagagtacttggaatagatgcttagtggattcttgttcagttgtgaacatggcacgc
ttttgcattcctgatagccaaacctggaatatgataccgctatctgttctcttcaactca
acaatggatgaatccaatcctagagatgagaatgaaattctcctcttatctgtttactgt
ggcagcttgtgcaagtacctaactgtagcttctgggagagcctccgtttttgtacttcga
gcacggacgaaaaatctcaagtcttgggatcatgctgtcggagtaatttgtgtacaggaa
gctggaggtcagattagtgactggagtgggaaaccgttggatcttgcagctgacctaact
gggcgcagagacatttacccttcaggtggtgttctcgtcaccaacggtgctctgcacggc
aagctggttgaaatgatctcagcaaatcacaagtag

DBGET integrated database retrieval system