KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343697Help
Entry
4343697           CDS       T01015                                 

Definition
(RefSeq) beta-hexosaminidase 2
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
osa00520  Amino sugar and nucleotide sugar metabolism
osa00531  Glycosaminoglycan degradation
osa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
osa00604  Glycosphingolipid biosynthesis - ganglio series
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4343697
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    4343697
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    4343697
   00604 Glycosphingolipid biosynthesis - ganglio series
    4343697
   00511 Other glycan degradation
    4343697
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     4343697
Chaperones and folding catalysts [BR:osa03110]
 Intramolecular chaperones
  Others
   4343697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 4343697
NCBI-ProteinID: XP_015645456
UniProt: A0A0P0X7V8
Position
7
AA seq 611 aa AA seqDB search
MSTNQGVQLRLAAQAKAAMATKNGGFVALLLLLSFLLSSPLPARCDAPLPVNVWPKPTSM
SWAEPHMAVRVSSSFHVVAPSGNAHLLSAARRYAALLLAERYRPLVTPAVNVTAGGAGAG
AAGRGAELGYLTLAVSDLHAPLQHGVDESYALEILPAGAAATVTAATAWGAMRGLETFSQ
LAWWCGRERAVLVAAGVRVEDRPLYPHRGLMLDTGRTYFPVADILRTIDAMAANKMNVFH
WHITDSQSFPLELPSEPALAEKGSYGDGMRYTVDDVKLIVDFAMNRGVRVVPEIDTPGHT
ASWAGAYPELVSCAGEFWLPDASDWPSRLAAEPGAGQLNPLEPKTYQVMSNVINDVTSLF
PDGFYHAGADEVTPGCWNADPSIQRYLARGGTLSRLLEKFVGAAHPLIVSRNRTAVYWED
VLLDQAVNVTASAIPPETTILQTWNNGGNNTRLIVRAGYRAIVSSASFYYLDCGHGDFAG
NDSAYDDPRSDYGTSGGSWCGPYKTWQRVYDYDVAGGLTAEEARLVVGGEVAMWTEQVDA
AVLDGRVWPRASAMAEALWSGNRDATGRKRYAEATDRLTDWRHRMVGRGVRAEPIQPLWC
RNRPGMCNLVR
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaatcagggggtgcagctccgattagcggctcaagctaaggcagccatggca
accaagaacggtggttttgttgcgttgctgctgctgctgtcgttcttgctgagctcgccg
ctgccggcgcgatgcgacgcgccgctccccgtcaatgtctggcccaagccgacgtccatg
tcgtgggcggagccccacatggccgtgcgtgtctcgagctcgttccacgtcgtcgccccg
tccgggaacgcgcacctcctctcggcggcgcggcgctacgccgcgctgctcctcgccgag
cggtaccggcccctcgtgacgccggcggtgaacgtcaccgcgggcggcgccggcgccggc
gcggcgggaaggggagccgagctggggtacctgacgctcgccgtgtccgacctgcacgcg
ccgctgcagcacggcgtggacgagtcgtacgcgctggagatcctccccgccggcgcggcg
gccacggtgaccgcggccacggcgtggggcgccatgcgcggcctcgagacgttctcgcag
ctggcgtggtggtgcgggcgggagcgggcggtgctggtggccgccggcgtgcgcgtcgag
gaccggccgctgtacccgcaccgcgggctgatgctggacaccgggaggacgtacttcccc
gtcgccgacatcctccggacgatcgacgccatggcggcgaacaagatgaacgtgttccac
tggcacatcacggactcccagtcgttccccctcgagctcccctccgagccggcgctcgcc
gagaagggctcctacggcgacggcatgcgctacaccgtcgacgacgttaagctcattgtc
gacttcgccatgaaccgcggcgtccgcgtcgtgccagagatagacacacccggccacacg
gcgtcgtgggccggagcttaccccgagctggtgtcctgcgccggcgagttctggctgccc
gacgcgtctgactggcccagccgacttgccgccgagccgggcgccggccagctcaacccg
ctggagcccaagacgtaccaggtgatgtccaacgtcatcaacgacgtcacctccctcttc
ccggacggcttctaccacgccggcgccgacgaggtcacgccggggtgctggaacgccgac
ccgtccatccagcgctacctcgcccgcggcggcacgctcagccgcctcctcgagaagttc
gtcggcgcggcgcacccgctgatcgtgtcccggaaccggacggcggtgtactgggaggac
gtgctgctggaccaggcggtgaacgtgaccgcgtcggcgatcccgccggagacgacgatc
ctgcagacgtggaacaacggcggcaacaacacgaggctgatcgtgcgcgccgggtaccgg
gccatcgtctcgtcggcgtcgttctactacctcgactgcggccacggcgacttcgccggc
aacgactccgcctacgacgacccgaggagcgactacggcaccagcggcgggtcgtggtgc
ggaccgtacaagacgtggcagcgggtgtacgactacgacgtcgcgggcgggctcaccgcc
gaggaggccaggctggtggtcggcggggaggtggcgatgtggacggagcaggtggacgcg
gcggtgctcgacggcagggtgtggccgagggcgtcggcgatggcggaggcgctgtggtcg
ggcaaccgcgacgccaccggccggaagcgctacgccgaggcgaccgaccggctcaccgac
tggcggcaccggatggtggggcgaggggtccgcgcggagcccatccagccgctctggtgc
aggaaccgcccgggaatgtgtaacttggtccggtga

DBGET integrated database retrieval system