KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343829Help
Entry
4343829           CDS       T01015                                 

Definition
Os07g0602200
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     4343829
Protein phosphatases and associated proteins [BR:osa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4343829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 695 aa AA seqDB search
MAAATTAAAAARVGLLYDERMCAHATPDGEEHPENPERLRAIWRKLSADGVASRCMIMKA
KEAEDKYIASVHSQNHIKLMRSISSKEYDSRRNKIARKFNSIYFNKGSSESAFLAAGSVI
EVAEKVAAGELSSAIALVRPPGHHAEHNEAMGFCLFNNVAIAADYLLNERTDLGIKKILI
VDWDVHHGNGTQKMFYSDPRVLFFSVHRFDYGSFYPAEGDASYCFIGEGDGKGYNINVPW
EHGKCGDADYIAAWDHVLLPVAEAFNPDIVLVSAGFDAALGDPLGGCCITPNGYALLLTK
LLGFAQGRIVMALEGGYNLRSIANSVSACAKVLLGDKFRFDTPDMQPFESSWRVIQAVRD
ELKTFWPVLSNRLPENISLRSRPSQIELYSSGSDSEVEDLPDAIASVNIIQITYGIISES
LSKLNLDEDKIATKTTSSNVMVEGPTDSVEPQNDGSAAVSTEGISSLSSTWRSELSKVYV
WYASFGSNMWTPRFLCYIQGGKAEGMNIPCFGSHDTSPPRGSMWKTVPHRLFFGRSSTPC
WGTGGVAFLNPEINHTENSYVCMYKITLEQFNDVLFQENRLVKENGESGKTESPDSPLIG
LSEIEFVSRNKGVHLAPIKDSWYSNVLYLGEEDNLPILTMTCPSSDVERCRSGELPLCPP
SKTYSATLIRGLMEGKHLDADAAASYINTAATRGL
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgacgaccgccgcggcggcggcgagggtggggctgctgtacgacgagagg
atgtgcgcgcacgcgacgcccgacggggaggagcacccggagaaccccgagaggctgcgg
gccatctggcgcaagctctccgccgacggcgtcgcctccaggtgcatgatcatgaaagcg
aaggaagctgaggacaagtatatagcttctgtccatagccagaaccatatcaagctgatg
aggagtatcagctcaaaagaatatgattcccgtcgaaacaagattgctagaaaatttaat
tccatttacttcaacaagggctcctcagagtctgcttttcttgcagctggttctgtgatt
gaggtagctgagaaggttgctgcaggagagttaagttctgctattgctctagtccgacct
ccaggtcaccatgctgaacataatgaggcaatgggtttttgcctcttcaacaatgtagca
attgctgctgattatctcttaaatgagaggactgacttaggtatcaagaagatattgatt
gtcgattgggatgttcatcatggaaatggcacacaaaagatgttttatagtgatcctcgt
gtattgttcttttcagttcacagatttgattatggcagcttctatcctgctgaaggggat
gcatcttactgtttcattggggaaggagatggtaaagggtacaacattaacgtgccctgg
gaacatggaaaatgtggtgatgcagattatattgctgcatgggaccatgtactacttcct
gttgctgaagcatttaaccctgatatagtcttggtgtctgctgggtttgatgcagcactg
ggtgatcctcttggtggctgctgcatcactcccaatggatatgctctgctactgacaaag
ctcttaggttttgcccaagggaggatagtgatggctcttgaaggaggctataaccttaga
tccatagcaaattcagttagtgcttgtgctaaagttttgttgggagacaagttcagattt
gacactcctgatatgcaaccgtttgaatcttcatggagagttatacaagcggtacgtgat
gaattgaagacgttctggcctgttctgagtaatagattgccagagaatatatcattgagg
agtaggccctcacaaattgagctgtattcttctggttctgactctgaagttgaagatctc
cctgatgctattgcttctgtcaatattattcaaattacttatggtattataagtgaaagc
ctctcaaagttgaaccttgatgaagacaaaatcgcaacaaagaccacctcaagtaatgta
atggttgaaggtccaactgattcagttgaaccacaaaatgatggatctgctgcggtgtca
actgaaggaatatcatctctatcttctacttggagatcagaactgtcaaaagtatatgtt
tggtatgccagctttggttcaaacatgtggacaccaaggtttctgtgctacatccaaggg
ggaaaggctgagggtatgaatataccatgttttggatctcatgacacaagcccaccaaga
ggttccatgtggaagactgtgcctcatagattgttttttggtagatcctctactccttgc
tggggaactggtggtgttgcttttctcaaccctgagataaaccacactgagaactcctat
gtctgcatgtataaaataacgctcgagcagttcaatgatgtattgtttcaagagaatcgt
ttagtgaaggagaacggcgaaagtggaaaaactgagtctcctgactctcctttgattggc
ttgtctgaaatagagtttgtttccagaaacaagggtgtccaccttgcacctattaaggat
agctggtactccaatgtactttaccttggggaggaggataaccttccaattcttacaatg
acatgcccgtcatcagacgtagagcgatgcagatccggagagctgccattgtgtcctcca
tccaagacctactccgccaccctgataaggggactaatggaagggaagcacctggatgca
gatgcggccgctagttacatcaacactgcagctaccagaggcctgtga

DBGET integrated database retrieval system