KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343919Help
Entry
4343919           CDS       T01015                                 

Definition
Os07g0618500
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4343919
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     4343919
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     4343919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 532 aa AA seqDB search
MLRAKETFRKMYSVAKNYCGGGLAASDALSVSALGRSLKPSRKASRHVVPCRARSFTQCS
LGGGSADQEIVIALGSNVGDRISTFDRALRMMKNSGVNITRHACLYETSPAYVTDQPRFL
NSAVRGTTKLEPHELLKKLKEIEKDIGRTDGIRYGPRPIDLDILLYGKSHISTENLTVPH
ERIHERPFVLAPLVDLLGSSTDDNVEKSWHSLAKCTGGFFESWDKLGGESIIGTEGIKRV
LPVGNRLLDWSERTLVMGVLNLTPDSFSDGGKFQEVEAAIAQTKLLISEGADIIDIGAQS
TRPLARRLSADEELERLVPVLDAITGIPEMEGKLLSVDTFYAEVAAEAVKRGVHIVNDVS
GGQIDPRILEVVAELGVPYVTMHMRGDPSTMQSEQNLLYGDVCKEVASELYKRVRQAELS
GIPLWRIVLDPGIGFSKNSKHNLEVIMGLESIRTEIGKMSLGASHVPILLGPSRKRFLGE
ICNRVNPTERDAATMVVATAGILNGANIVRVHNVKYGVDTAKVSDALSKGRR
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtgctaaggagacattcaggaagatgtactcggttgccaagaactactgcgga
ggagggttagctgcgtcggatgcgctatcagtatctgctcttgggcgttctctgaaaccc
tcgcggaaagcatcgaggcatgttgttccgtgcagggcgcgctcgtttacgcagtgttcc
ctagggggtggttctgcggaccaggagattgtgattgcactgggcagcaatgtgggggat
agaatcagtacgtttgacagggcattgcgtatgatgaagaactcgggtgtaaatatcacc
aggcatgcctgcttgtatgagacttccccggcttatgtgactgatcagccgcggttcctg
aactctgctgttaggggcacaaccaagctggaacctcatgaattgctcaagaagctaaag
gaaattgagaaggatatagggcgcactgacgggataaggtatggtcccagaccgatcgat
ctggacattcttctatatggcaaatcacatattagtactgagaatctaactgtgccacat
gaacgcatccatgagaggccgttcgttttagcacctcttgttgaccttctaggctcatcc
actgatgataacgtggaaaaaagttggcattctcttgcaaagtgcactggtgggttcttt
gaatcatgggataaacttggaggtgaatctataattggaacagaaggaattaaaagggta
ttgccagtcggaaatcgtctgttggattggtctgagaggactcttgtcatgggggtgctt
aatttgacaccagacagcttcagtgatggtggtaagtttcaggaagtggaagctgccatt
gctcagaccaagttattaatatcagaaggtgcagacatcattgatattggtgctcaatcc
actaggccccttgcaagaagattatctgcagacgaagagcttgagaggttggttcctgtt
ctagatgcgatcacaggaattcctgagatggaaggcaagctgctctcagtggatacattc
tatgcagaagtcgctgctgaagctgtgaaaagaggagtacacattgttaatgatgtatct
ggtggacagattgacccaagaattcttgaagttgtagctgaacttggagttccatatgtg
actatgcatatgagaggagatccatctactatgcaaagtgaacagaatctactatacggt
gatgtttgtaaagaagttgcttctgagctatataaaagggtgagacaagcagagttgtct
gggattcctttgtggaggatagttcttgatcctggtattggattctccaagaattccaaa
cataaccttgaagttatcatgggtttggaatctattagaacagagataggtaaaatgagt
ttaggtgcttcacatgtgccaattttacttggaccctcaaggaaaagatttttaggtgaa
atatgcaatcgtgtcaatcccactgagagagatgctgctaccatggtcgttgctactgct
gggatattgaatggtgctaatatagtaagggtgcataatgttaaatatggcgtggatact
gcaaaggtctctgatgcattgagcaaaggcagaagatga

  All links  
No link information was found.   
DBGET integrated database retrieval system