KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343971Help
Entry
4343971           CDS       T01015                                 

Definition
Os07g0626600
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     4343971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 450 aa AA seqDB search
MGSMEASTAPENGTAAAAAAAASTACNGAGGGGGAAAASNGGGVERRLRSSAASASWASH
LPLEVGTRVMCRWRDQKLHPVKVIERRKSSTSSSPADYEYYVHYTEFNRRLDEWVKLEQL
DLETVETDVDEKVEDKATSLKMTRHQKRKIDETHVEQGHEELDAASLREHEEFTKVKNIA
KIELGRYEIDTWYFSPFPPEYNDSPKLFFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEI
YRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVG
YFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLS
YRGYWTRVLLEILKKHKSNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPK
VLDRHLKAAGRGGLEVDVSKLIWTPYKEQG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgatggaggcgtccaccgcgccggagaacggcaccgccgccgccgcggcggcc
gcggcctcgacggcgtgcaacggcgcgggcggcggcggcggcgccgccgccgcctcgaac
ggcggcggggtagagaggaggctgaggtcctccgccgcgtccgcgtcgtgggcgtcgcat
ctgccgctggaggtgggcacgcgcgtgatgtgccggtggcgcgaccagaagctccatccc
gtcaaggtcatcgagcgccggaagtcctccacctcctcctcccccgccgattacgagtac
tacgtccactacaccgagttcaataggaggctcgatgagtgggttaaacttgaacaactt
gatcttgagactgttgagaccgatgttgatgagaaggtagaagataaggcaacaagcttg
aagatgacacggcaccagaagcgtaaaattgatgaaacccatgtggagcaaggtcatgag
gagcttgatgctgctagtttgcgggaacatgaagagttcacaaaggtgaaaaatatagcg
aagatagaacttgggagatatgagatagatacatggtatttctctcctttcccaccggag
tataatgactctccaaagctgttcttctgtgagttttgcctcaacttcatgaagcgcaag
gaacagcttcagaggcacatgaaaaaatgtgatcttaaacatccccctggtgatgaaata
tacagaagtggaaccctgtctatgtttgaggttgatggcaagaagaacaaagtttatggg
cagaacctttgttatcttgccaaactatttcttgatcacaagacactttattacgatgtt
gatttgtttttgttctacgtcctgtgtgaatgtgatgatcgggggtgtcatatggtgggg
tatttctccaaggagaaacactctgaggaatcttacaatttggcttgcatcctcactctc
cctccatatcaaagaaaaggatatgggaagttcctgattgccttctcctatgagctttct
aagaaggaaggtaaagtagggacaccggagcgccctctttctgatcttggtctgctcagt
tatagaggttattggactagagtgcttctagagattttaaagaaacataagagcaacata
tccattaaggagcttagcgatatgacggcaataaaagcggacgacatcttgagcacgctt
cagagtctggacctgatccagtaccggaaaggtcagcacgtcatctgcgctgaccccaag
gttctcgaccgccacctcaaggccgccggccggggtggcctcgaggtcgacgttagcaag
ctgatctggacaccctacaaggaacaaggctaa

DBGET integrated database retrieval system