KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343975Help
Entry
4343975           CDS       T01015                                 

Definition
Os07g0627000
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4343975
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     4343975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 133 aa AA seqDB search
MWSAFGGGSDNPHLPHNHEFDQVVYTGTHDNDTVIGWWQTLPEEEKQTVFKYLPEANRTE
ISWALITAALSSVARTSMVTMQDILGLDSSARMNTPATQKGNWRWRMPSSVSFDSLSPEA
AKLKELLGLYNRL
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcagcttttggcggtggttctgacaatccacacttgccccataaccatgaattt
gatcaagtagtatacaccggaacacacgacaatgacacggttattggttggtggcaaact
ttaccagaggaagagaagcagactgtgttcaagtatctgcctgaggctaataggactgaa
atctcatgggcactgatcactgctgccctctcttcagttgcaaggacatccatggtaacc
atgcaggacattcttggcctcgacagttctgctagaatgaatactccagctacacagaaa
gggaactggagatggaggatgccgagctctgtcagcttcgacagcctcagccctgaagcg
gcgaagctgaaggaattgcttggactgtacaaccggctctaa

DBGET integrated database retrieval system