KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344039Help
Entry
4344039           CDS       T01015                                 

Definition
Os07g0637300
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     4344039
Protein kinases [BR:osa01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   4344039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 363 aa AA seqDB search
MASEPVARAVAEEVGRWGSMKQTGVSLRYMMEFGSRPTERNLLLSAQFLQKELPIRIARR
ALELESLPFGLSRKPAILKVRDWYLDSFRDIRYFPEVRNRNDELAFTQMIKMIKVRHNNV
VPTMALGVQQLKNEQYRTRKIPTAFDEIHEFLDRFYMSRIGIRMLIGQHVALHDPDPEPG
VIGLINTELSPIQVAQAASEDARSICLREYGSAPEIDIYGDPTFTFPYVSSHLHLMLFEL
VKNSLRAVQERYMNSDKDVPPVRIIVADGAEDVTIKVSDEGGGIPRSGLPRIFTYLYSTA
KNPPDMDCPSEGVTMAGYGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSEE
PLP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggagccggtggcgagggcggtggcggaggaggtggggaggtgggggagcatg
aagcagacgggggtgagcctgcgctacatgatggagttcgggtcgcgccccacggagcgg
aacctgctgctctccgcgcagttcctgcagaaggagctcccaatccggatcgcgcgccgc
gcgctcgagctcgagtccctccccttcggcctctcccgcaagcccgccatcctcaaggtg
cgggattggtacttggactctttccgcgacatcagatactttccagaagtgaggaatagg
aacgacgagctcgcttttacgcagatgatcaagatgatcaaagtacgccacaataatgtg
gttccaacgatggcactgggagttcaacagctcaagaacgagcagtatcgcacaaggaag
atccccactgcatttgacgagatccacgagtttcttgacagattctacatgtcaaggatt
gggatccgcatgcttatagggcagcatgtggctttgcatgatcctgacccagagcctggc
gtcataggcctcattaatacagaattgtcccctatacaggtggctcaagctgccagtgaa
gatgcccgttctatttgtttgagggaatatggatcagctcctgagattgacatctatgga
gacccaacttttacatttccatatgtttcatcacatctacatctcatgctatttgaattg
gtgaagaactccttgcgtgcagtacaggaacgatatatgaattccgataaagatgttcct
ccagttagaattatcgttgctgatggggcagaggatgtaactatcaaggttagtgatgaa
ggtggtggaataccaaggagcggccttccaagaattttcacatatctatatagcactgca
aagaatccacctgatatggattgccctagtgaaggagtaactatggctggatatggctat
ggtcttccaatcagtcgcctgtatgctcgatattttggtggtgacctgcaaatcatctct
atggaaggatacggcaccgatgcttacctgcacttgtcacggttgggagattcggaggag
cccttgccttga

DBGET integrated database retrieval system