KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344181Help
Entry
4344181           CDS       T01015                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 24
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4344181
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   4344181
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    4344181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 669 aa AA seqDB search
MGSSKANHPAASSSKVSSVSSSKPKPKPTPIRNPTPPPPPPRRRTPPPPPPGSGPGPQRP
SYLSVALRRRGPPAGSAAGTPAPPRAAAAFDVAPPVAEHTDPVVFPASLAEMSGGGGSSS
SDDQILLFGSFTEAETKLWQPNANKTRELSEIQFGSLNFSALNLSKESNSITQGAVYPAK
LSDGQNKIIITKDIACSNKKETVAPTLPNGKPVLFNGSPTANANVSPNNGVIENNQKAVA
AVLTSVPAKNVSSPAPLSVPEVDHDGIERNQNSSLVPEITENGGPAIDTPTTAAPVDELV
TSLNKKDFRNKPLLPHGLKNTGNICFLNSSLQALLSCWPFVQLLQNLRNQNIPKAGYPTL
NAFIEFISQFDVLDDSNVKKDEKFATIASKSVIPSMFDTVLRNFTPDVPAGTASRPRQED
AQEFLSFAMDRMHDELVKLNGNGSNSKEGMIVSSNDDDAWETVGKKNKSAIMRSQSFVPS
ELTAIFGGQLQSCVKATGNKASVTVQPFRLIHLDIFPDAVQKLDDALRLFAAPESLEGYR
TAAGKAGLVTARKSVKIHSLSKIMILHLKRFSYGSHGCTKLFKPIHFPLELVLSRDLLSS
PSSEHMQSRRYELVATITHLGANPSRGHYTADAKSASGQWLRFDDDNVTPVSLNKVLHDQ
AYVLFYKQL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcagcaaggccaaccacccggcggcttcctcgtccaaggtctcctccgtctcc
tcctccaaacccaaacccaaacccaccccgattagaaaccctacgcctccgcctcctcct
cctcgccgccgcacgcccccgcctccgccgccggggtcgggcccggggccgcagcgacct
tcctacctctcggtagcgctccgccgccgcgggcctcccgcgggcagcgcggccgggacc
ccggcgccgccgcgcgccgccgccgcctttgatgtcgcccccccggtcgccgagcacacg
gaccccgttgtcttccccgcttcattagccgagatgagcggcggcggcggcagcagcagc
agcgacgatcagatccttctgtttgggagcttcacagaggctgaaaccaagttgtggcag
cctaatgcaaataaaacacgggaactctctgagatccagtttgggtcactgaatttctca
gctctaaatttatcgaaagaatcaaattctattactcaaggtgctgtctatcctgcaaaa
ttaagtgacggccagaacaaaatcatcattacaaaggatattgcatgcagcaacaaaaag
gaaacagtagctcctacattaccaaatggcaagccagtgctattcaatggatctcccact
gccaatgccaatgtgtctcccaacaatggcgtcattgagaataatcagaaggctgtagct
gcagttctcacgagtgttcctgctaaaaatgtcagcagcccagcaccactttcagttcca
gaggtggaccatgatgggatcgaacgcaatcaaaacagcagtttagtcccagaaataact
gaaaatggagggccagctattgatacaccaactactgcagctccagtggatgagcttgtg
acaagcttaaataaaaaggactttcggaacaagcccttgcttcctcatggtttgaagaat
acaggaaatatatgcttcctgaattcatccttgcaggcattgctctcatgctggcctttt
gtccagcttttacagaacttgaggaaccagaatatacctaaggctggttacccaacactg
aatgcatttattgagttcatctctcaattcgacgtgctcgatgattcaaatgttaagaaa
gacgagaagtttgctacaatagcttcaaaatcagttattccctccatgtttgacacagtt
ctgagaaattttactccagatgtgccagctggaacagcttctaggccaaggcaggaagat
gctcaagaattcttaagttttgcgatggatagaatgcatgatgaactagtgaagcttaat
ggcaatggctcaaattcaaaggagggtatgattgtttcatcaaatgatgatgatgcttgg
gagactgttggaaagaagaacaagtcagccataatgaggagtcagagttttgttccctcc
gagttaactgctatttttggaggccagctgcaaagctgtgtgaaagctactggtaacaaa
gcatcagtcaccgttcagccttttcgactgatccatcttgacatattccccgatgctgtt
cagaaacttgatgatgcccttcgtctgtttgctgctcctgaatctttggaaggatacaga
acagctgctggaaaggctgggttggtgacggctagaaaatcagtgaagatacactcactt
tcaaagataatgatactgcacctgaagaggtttagttatggaagtcatggctgcacgaaa
ctcttcaagccaattcacttccctcttgagctggttcttagtcgtgatctgctgagttcg
ccatcatcagagcacatgcagagtagaagatatgagcttgttgcaaccatcacgcatctt
ggggcaaacccgtccaggggccattacactgccgatgcaaagtctgccagtgggcagtgg
cttcgcttcgacgatgataacgtcacacctgtcagtctgaacaaggtcttgcatgaccaa
gcatatgtcctgttctacaaacaattataa

DBGET integrated database retrieval system