KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344192Help
Entry
4344192           CDS       T01015                                 

Definition
Os07g0662900
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4344192
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     4344192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 946 aa AA seqDB search
MTNLSGKKSLNTVTLVFKLPYYTQWGQSLLIAGSEPALGSWNVKQGLSLSPVHQGNELIW
SGRVSVATGFTCQYNYYVVDDNKNVLRSESGEKRKLVLPEGVQDGDVVEIRDWWQDASEA
LFLRSAFKNVIFNGSENAKRELKTTSLNKSLEPEDIVVQFIVSCPRLGAGSTVVVTGSNP
QLGRWQTQDGLKLNYVGDSIWKANCLLRKSEFPIKYKYCKISEAGVSSLEFGPNREADVD
LSSPKPSRYVLLSDGALRESPWRGAGVAVPIFSIRSNEDLGVGEFLDLKLLVDWAVNSGF
HLVQLLPINDTSVHGMWWDSYPYSSLSVFALHPLYLRVQALSDAIPGDIKDEISQAKKQL
DKKDVDYEASLASKLSIARKIFKLEKDKVLNSSSFKQFLSENEEWLKPYAAFCFLRDFFE
TSDHSQWGRFSQFSKEKLDKLVSEGTLHHDVICFHYYIQYHLYMQLSEAAAYARKKKVIL
KGDLPIGVDRNSVDTWVYPTLFRMNTATGAPPDYFDKNGQNWGFPTYNWEEMSKDNYGWW
RARLTQMAKYFTAYRIDHILGFFRIWELPDHAATGLVGKFRPSIALSQEELLSEGLWDFD
RMSRPYILQETLEEKFGSFWTVIAANFLNEYKKQHYEFKEDCNTEKKIIAKLKNSSEKSL
WLEKEDSIRRGLFDLLQNIVLIRDPEDSTKFYPRFNQEDTSSFNDLDEHSKNILRRLYYD
YYFARQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPS
EPNLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDGGRRSRFYQTVIGSDDEPPSRCTPE
VANFIVKQHFDAPSMWAIFPLQDLLALKDKYTTRPAKEETINDPTNPKHYWRFRLHVTLD
SLLDDKDIQATIKELVTSSGRSFPGKVDGAEESGEKLAKVQLNGKP
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttgtccgggaagaaatctctgaatacagtgaccttggtcttcaaattaccc
tactacacacaatgggggcagagtcttctcatcgccggctcagagccagcacttggatct
tggaatgttaagcaaggattgtctctcagtccagttcatcagggaaatgagctaatctgg
tccggcagagtttccgtcgctactggttttacctgccagtacaattactatgtagtggac
gacaacaagaatgttttgagatcggagtccggggagaaaaggaaattagtacttccagag
ggtgttcaggatggagatgtagttgagatacgcgactggtggcaggatgcttctgaagct
cttttccttcgaagtgcattcaagaatgtcattttcaatgggtctgaaaatgctaaaaga
gaattgaagactacatccctcaacaaaagtttggagcctgaagatattgttgttcagttt
attgttagctgtccccgacttggagctggctctactgtcgtggtcacaggaagtaatcct
caattaggaaggtggcaaacacaagatggcctcaagcttaattatgtcggagattccatc
tggaaagcaaactgtctgttgcgaaagtctgagttcccaataaaatataaatactgtaaa
attagtgaagcaggagtctcttcattggagttcggtccgaacagggaggctgatgtggat
ctatcatcacccaagccatccagatacgtcctcttgtctgatggtgcccttcgggaatca
ccatggaggggtgcaggtgttgctgtacctatattctcgatcaggtcaaatgaggacctt
ggtgttggagaattccttgatcttaaacttcttgttgactgggcagtcaactcaggcttt
catcttgttcagcttcttcctatcaatgatacttcagttcacgggatgtggtgggattca
tacccatacagctcgctctctgtgtttgcattgcaccccttgtacctgagagtacaagca
ctttcagatgcaattccaggggatattaaggacgagatttcacaggcaaagaagcagttg
gacaaaaaggatgttgactatgaggcatcactggcctcaaaactctcgatagcaagaaaa
atattcaaattagagaaagacaaagtactaaattccagttcgttcaagcagtttttatct
gaaaacgaggagtggttgaaaccatatgctgcattttgttttctgcgggacttctttgag
acatcagatcacagccaatggggccgtttttctcagttttccaaggagaagctagataag
cttgtttctgaaggtaccttgcaccatgacgttatatgtttccattactacatccagtac
catctatatatgcaattatcagaggcagctgcctatgcaaggaagaaaaaggttattctg
aaaggagatttacctattggtgttgataggaatagtgtggatacttgggtataccccact
ttatttcgcatgaatacagctactggtgcacctccagattatttcgacaaaaatggacaa
aattggggttttcctacatataactgggaggaaatgtcaaaggataattatgggtggtgg
cgagctcgtctgacacagatggcaaaatacttcactgcatataggatagaccatatcttg
ggtttctttaggatatgggagcttccagatcatgcagccacaggtctagttgggaaattt
aggccttcaattgctctcagtcaggaggagcttcttagtgaaggcctatgggatttcgat
agaatgagccgcccttatattcttcaggaaacactggaggagaagtttgggtccttttgg
acagtaattgcagctaactttctaaatgagtacaagaaacaacattacgagttcaaagag
gactgcaatacagagaaaaagataattgcaaagcttaagaacagttctgaaaaatcatta
tggctggagaaagaagacagcattcggcgtggtttgtttgatctactacagaatatagtc
cttattagagatccagaggacagcacaaaattttatccccgcttcaaccaggaggatact
tcaagttttaacgatctagatgaacatagcaaaaatatcctcagaagattgtactatgac
tattattttgctcgccaagagaatctctggcgtcaaaatgcgctcaagactctgcctgtg
cttttgaactcatcggatatgttggcatgtggggaagatcttggccttatccctgcctgt
gttcaccctgttatgcaagaacttggattgattggattgcgtatccagagaatgcccagt
gaaccaaacttggaatttggtattccatctcagtatagctacatgacggtttgtgctccg
tcatgtcatgattgctccacattacgtgcttggtgggaagaagatggaggaagaagaagc
cgtttctaccagactgtaattggtagtgatgacgagccgccatctcgctgcaccccagaa
gtagcgaactttattgttaagcagcattttgatgctccatcaatgtgggcaatcttccca
ctacaggacctgcttgcacttaaagacaagtacaccacaagaccagcaaaagaggaaaca
atcaatgacccaactaacccgaagcattattggagattccggctacatgtgacattggat
tcgctgttggacgataaggacatccaagcaaccatcaaggaacttgtcacaagtagtggg
aggtcatttcctggtaaggtggatggcgccgaagaaagcggagagaagctagctaaagtc
cagttgaatggtaaaccatag

DBGET integrated database retrieval system