KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344231Help
Entry
4344231           CDS       T01015                                 

Definition
Os07g0669100
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4344231
   00051 Fructose and mannose metabolism
    4344231
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     4344231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 479 aa AA seqDB search
MMGAKLLLLLVASSLCLSAAIATQQTCPADLDSKCGDAASGDWEGEFFPGIPKIKYEGPS
SKNPLAYKWYNAEEVILGKKMKDWMRFSVAFWHTFRGTGGDPFGAPTKSWPWEDGTNSLD
MAKRRMRAHFEFMEKLGVDRWCFHDRDIAPDGKTLTETNKNLDEIVELAKKLQEETNIKP
LWGTAQLFMHPRYMHGAATSPEVKVYAYGAAQVKKALEVTHYLGGENYVFWGGREGYQTL
LNTDMKRELDHLASFLQAAVDYKKKIGFNGTLLIEPKPQEPTKHQYDWDVATTFSFLQKY
GLTGEFKINVECNHATLSGHSCHHELETARINGLLGNIDANTGDPQIGWDTDQFLTDISE
ATLVMSSVVKNGGLAPGGFNFDAKLRRESTDVEDMFLAHISGMDTLARGLRNVVKLIEDG
SLDELVRKRYQSFDSEIGALIEAGKGDFETLEKKVLEWGEPIVPSGKQELAEILFQAAL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatgggggcaaagcttttgctcttactggtggcctcatctctatgtctatctgctgcg
atcgctacgcagcaaacctgtccggccgacctcgatagcaagtgtggtgatgctgcttca
ggggattgggaaggggagttcttccctggcatccccaagatcaagtatgagggtccaagc
agcaagaacccgcttgcttacaagtggtacaatgctgaggaagtgattcttgggaagaag
atgaaggattggatgcggttcagcgtggccttttggcatacgttccgtggtactggagga
gatccttttggtgcccctacaaagtcttggccttgggaggatggcacaaattcgttggac
atggctaagagaagaatgagagctcactttgagttcatggagaagcttggagttgacagg
tggtgcttccatgacagggatattgcccctgatggcaaaacactcacggaaacaaataaa
aatttggatgagatagttgaactggcaaagaaactccaggaggagaccaatataaaacca
ctgtgggggactgcacagcttttcatgcacccgcgctacatgcacggtgctgctactagc
ccagaggttaaagtgtatgcttatggtgctgctcaagttaagaaagctttagaggtcacc
cactacctaggcggtgaaaactatgttttctggggaggaagagagggttaccaaactctt
cttaatactgacatgaagagagaacttgaccatttggctagttttcttcaagctgcagtt
gactacaagaagaagattggatttaatggaacactcttgatagagcctaaaccacaagaa
cccacaaaacaccagtacgattgggatgttgcaaccacattctctttcctacagaaatat
ggtctaacaggagaattcaagataaatgttgaatgcaaccacgctactctatctggacat
agctgccaccatgagcttgagactgcaagaattaatggtctgcttgggaatattgatgcc
aacactggtgatccccagatcggttgggacaccgatcagttccttacagatatttcagag
gctactttggttatgtcaagtgtggttaagaatggtgggcttgcacctggtggattcaac
tttgatgccaaattgaggagggagagtactgatgttgaggacatgtttctggctcatata
tcgggaatggacaccctagcccgcggccttcggaatgttgtcaagctgatcgaggatggt
tccctggatgagcttgttcgcaagcgctaccagagttttgatagtgagatcggtgccttg
attgaggctgggaaaggagacttcgagacactagagaagaaggttctggagtggggtgaa
cccattgttccatctggcaagcaggaactggctgagattctgttccaagctgctctatag

DBGET integrated database retrieval system