KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344290Help
Entry
4344290           CDS       T01015                                 

Gene name
OJ1205_F02.7, OJ1409_C08.26
Definition
(RefSeq) alpha-galactosidase 3
  KO
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    4344290 (OJ1205_F02.7)
  Lipid metabolism
   00561 Glycerolipid metabolism
    4344290 (OJ1205_F02.7)
   00600 Sphingolipid metabolism
    4344290 (OJ1205_F02.7)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    4344290 (OJ1205_F02.7)
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     4344290 (OJ1205_F02.7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 425 aa AA seqDB search
MEAPRLRLPFLLLVALVVSPPAVAAAASRMRIEPLPTAALRRLYDTSNYGKLQLNNGLAL
TPQMGWNSWNFFACNINETVIRDTADALVSTGLADLGYNYVNIDDCWSNVKRGKKDQLLP
DPKTFPSGIKDLADYVHGKGLKLGIYSDAGIFTCQVRPGSLHHEKDDAAIFASWGVDYLK
YDNCYNLGIKPKDRYPPMRDALNSTGRQIFYSLCEWGQDDPALWAGKVGNSWRTTDDIQD
TWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMTFAEYRAHFSIWALMKAPLLIGC
DVRNMTKETMEILSNKEVIQVNQDPLGVQGRRILGQGKNGCQEVWAGPLSGNRLAVVLWN
RCEESANIIVKLPSVGLDGSSPYSVRDLWKHETLSENVVGTFGAQVDVHDCKMYIFTPAV
TVASS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgccgcgcctccgcctcccgttcctcctactggtggccctcgtcgtctcgccg
ccggcggtcgccgcggcggcgagccgaatgcggatcgagcccctccccaccgccgcgctg
cgccgcctctacgacacctccaactacggcaagctgcagctcaacaacggcctcgccctc
accccgcagatgggatggaacagctggaatttcttcgcctgcaacatcaacgagacggtc
atccgcgacacagctgacgcactagtctcgacggggctggctgatttgggctacaactat
gtaaatatcgatgattgttggtccaatgtaaaaagaggaaaaaaggatcaattgctacct
gacccaaaaactttcccttctggcatcaaagatcttgcggactatgtgcatgggaaaggt
ctaaagcttggtatctactctgatgctgggatttttacatgtcaagttcgacctggatcg
ctccatcatgaaaaggacgatgctgcaatatttgcttcatggggtgttgattacctgaag
tatgacaactgctacaatttgggaataaagcccaaggacaggtatcctccaatgcgtgat
gctttaaattcaactggacgccaaatattctactctctatgtgaatggggccaggatgat
ccagccttatgggctggcaaagttggtaacagttggcgcacaacagatgacatacaggat
acatggaaaagcatgactgatattgctgataagaataacaagtgggcatcatatgctgga
cccggtggatggaatgacccggatatgctggaagtcgggaatggtggcatgacctttgca
gagtatcgtgcacattttagcatctgggcacttatgaaggcccctctcttaattggttgc
gatgtcagaaacatgactaaagaaacaatggaaatattgagcaacaaagaagtaattcaa
gtaaatcaagatcctcttggagttcaaggaagaagaattttaggtcaagggaaaaatgga
tgccaagaggtgtgggctggccccctctctggtaaccgtctggctgttgttttatggaac
cgctgtgaggagtctgccaatattatagtaaaattgccatctgtaggccttgatggttca
tctccctattctgttagagatctgtggaagcatgaaactctatcagagaacgttgttgga
acttttggggcgcaagttgacgtgcatgactgcaaaatgtatattttcactcccgccgtc
accgttgcatcaagttga

DBGET integrated database retrieval system