KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344391Help
Entry
4344391           CDS       T01015                                 

Definition
Os07g0694000
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4344391
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    4344391
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     4344391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 598 aa AA seqDB search
MGTYKCCLIFKRRFRWNDAPPPDDVRALFANHSAGGGPHMAADGLRAYLQATGQDGDVDM
ERLVEQIRQLQGRGGRIPRVGRALPLLTVDDFHRFLFSHELNPPIRHGQGQVHHDMAAPL
SHYFIYTGHNSYLTGNQLSSDCSDLPIIRALQRGVRVIELDMWPNSSKDDISILHGRTLT
TPVSLLKCLLSIKQHAFEASPYPVIITLEDHLTPDLQDKAAKMVLEVFGDILYYPDKDHL
KEFPSPQDLKGRVLLSTKPPREYLQAKDGNAATIKEDAKAAATDDAAWGKEVPDIHSQIH
SATKHDQREDDDDTDEDEDDEEEEQKMQQHLAPQYKHLITIKAGKPKGTLLDALQSDPEK
VRRLSLSEQQLAKLADHHGTEIVRFTQRNLLRIYPKGTRVTSSNYNPFLGWVHGAQMVAF
NMQGYGRALWLMHGFYKANGGCGYVKKPDFLMQTDPEVFDPKKSLSPKKTLKVKVYMGDG
WRMDFTQTHFDQYSPPDFYARVGIAGVPADSVMKRTRAIEDNWVPVWEEDFTFKLTVPEI
ALLRVEVHEYDMSEKDDFGGQTVLPVSDLIPGIRAVALHDRKGIKLNNVKLLMRFEFE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgtacaagtgctgcctcatcttcaagcgccgcttccgctggaacgacgcgccg
ccgcccgacgatgtccgcgccctcttcgccaaccactccgccggcggtggcccccacatg
gccgccgacggcctccgcgcctacctccaggccaccggccaggacggcgacgtggacatg
gagcggctggtggagcagatccggcagctgcaggggcgcggcgggcgcatcccgcgggtg
gggcgggcactcccactcctgacggtggacgacttccaccgattcctcttctcccacgag
ctgaacccacccatccggcacgggcaggggcaggtgcaccacgacatggccgccccgctc
tcccactacttcatctacaccggccacaactcctacctcaccggcaaccagctcagcagc
gactgcagcgacctccccatcatcagggctctccagaggggcgtccgcgtcatcgagctc
gacatgtggcccaactcctccaaggatgacatcagcatcctccatggcaggacgctcacc
accccggtctccctcctcaaatgcctcctctccatcaagcaacacgcctttgaggcctcc
ccttacccggttatcatcacgctcgaagaccacctcacccccgatctccaggacaaagca
gccaagatggttcttgaagttttcggcgacatcctctactaccctgacaaagatcacctc
aaagagttcccttcgcctcaagacctcaagggccgtgtcctcctctccaccaagcccccc
agggagtaccttcaagccaaggatggtaatgctgccaccatcaaagaggacgccaaggcc
gccgccactgacgatgccgcatggggaaaagaagtcccagatattcactctcaaatccac
tctgccactaaacatgaccaaagagaagatgacgacgacaccgatgaagacgaagatgac
gaggaggaggagcagaaaatgcaacagcatctagctccacagtacaaacaccttattacc
atcaaagcaggaaagccaaaaggtactctacttgatgccttacagagtgacccagaaaag
gttagaaggctcagtttgagcgagcaacaacttgccaaattggcagatcatcatggtacc
gaaattgtaaggttcacacagagaaacctactgaggatatacccaaagggcactcgggtc
acatcatccaactataatccatttcttggttgggtgcatggtgctcagatggtagcgttc
aatatgcagggatatggaagagctctttggttgatgcatggattttataaagctaatggt
ggctgtggttatgtgaagaaaccagatttcttaatgcaaactgatccagaggtttttgac
ccaaaaaaatccctatctcccaagaaaaccttgaaggtgaaagtatacatgggggatggt
tggcggatggacttcacgcagacccactttgatcaatattctcctccagacttttatgca
cgggtggggatagcgggagtaccagcggactcggtgatgaagagaacgagggcgatagag
gataactgggtgccggtgtgggaggaggatttcaccttcaaactgaccgtgccggagatc
gcgttgctgcgggtggaggtgcacgagtacgacatgtcggagaaggacgacttcggcggc
cagacggtgctgccggtgtcggatctcatcccggggatccgagcggtggcactccacgac
cgcaaagggatcaagttgaacaacgtcaagcttctcatgcgcttcgagtttgaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system