KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344698Help
Entry
4344698           CDS       T01015                                 

Gene name
MPK2
Definition
(RefSeq) mitogen-activated protein kinase 2
  KO
K20600  
mitogen-activated protein kinase 4 [EC:2.7.11.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    4344698 (MPK2)
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     4344698 (MPK2)
Protein kinases [BR:osa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   4344698 (MPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 394 aa AA seqDB search
MRMEGGGGGGHGHHGGGGGGHGHHGGIGGGEAQIKGTLTHGGRYVQYNVYGNLFEVSSKY
VPPIRPVGRGACGIICAVVNAQTRQEVAIKKIGNAFDNQIDAKRTLREIKLLRHMDHDNV
ISIKDIIRPPRRENFNDVYIVYELMDTDLHHLLRSNQPLTDDHCQYFLYQVLRGLKYVHS
ANVLHRDLRPSNLLLNAKCDLKIGDFGLARTTNETDFMMEYVVTRWYRAPELLLNCSEYT
AAIDIWSVGCILGEIVTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRS
LPQYPKQQFRARFPTMSSGAMDLLERMLVFDPSKRITVDEALCHPYLASLHEIYDEPVCP
APFSFDFEQPSLTEEDIKEIIWREALKFNPEPIH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatggagggcggcggcggcggcggccatggccatcacggcggcggcggcggtggc
catggccatcacggtggcatcggaggaggggaggcgcagatcaaggggacgctgacgcac
ggcgggaggtacgtgcagtacaacgtgtatggtaacctgttcgaggtttcgtccaagtac
gtccctcccatccgccccgtcggccgcggcgcctgcggcatcatctgtgcggttgtgaat
gcgcagactcgtcaggaggtggcaatcaagaagatcggcaacgcgttcgacaaccagatc
gacgccaagcgcaccctgcgagagatcaagctgcttcggcacatggatcatgataatgtc
atctcaataaaggacatcatacggccaccaaggagggagaacttcaatgatgtctacatt
gtctatgagctcatggacactgatcttcaccaccttcttcgatcaaaccagccactaaca
gatgatcactgtcagtattttctctatcaggtactacgaggattgaagtatgtgcattca
gcaaatgtcttgcacagagacctcaggccaagtaatttgctgctgaatgcgaaatgcgat
cttaagatcggagactttggattagcaaggaccacaaatgaaactgacttcatgatggag
tatgttgttactcgatggtacagggcacctgaactcctgctaaactgctcagagtacact
gcagctattgatatctggtcggtaggctgcatccttggtgagatcgttacaagggagcct
ttgtttcctggaaaggattatgtccatcagctgaggctaataactgagttaataggctca
cctgatgactcgagccttgggtttcttcgaagcgacaacgcccgcagatatgtgaggtcg
cttcctcaataccccaagcaacaattccgtgcacggttccccactatgtctagtggtgcc
atggatttgcttgagaggatgcttgtgtttgatcccagcaaaaggattactgttgatgaa
gctctgtgccatccatacttggcatcccttcatgagatatatgatgaaccagtctgccca
gcgcctttcagcttcgatttcgagcagccgtcgctcaccgaagaagatatcaaggagatc
atatggagggaggcacttaagttcaaccctgaaccaattcactag

DBGET integrated database retrieval system