KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344698Help
Entry
4344698           CDS       T01015                                 

Gene name
MPK2
Definition
(RefSeq) mitogen-activated protein kinase 2
  KO
K20600  
mitogen-activated protein kinase 4 [EC:2.7.11.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 394 aa AA seqDB search
MRMEGGGGGGHGHHGGGGGGHGHHGGIGGGEAQIKGTLTHGGRYVQYNVYGNLFEVSSKY
VPPIRPVGRGACGIICAVVNAQTRQEVAIKKIGNAFDNQIDAKRTLREIKLLRHMDHDNV
ISIKDIIRPPRRENFNDVYIVYELMDTDLHHLLRSNQPLTDDHCQYFLYQVLRGLKYVHS
ANVLHRDLRPSNLLLNAKCDLKIGDFGLARTTNETDFMMEYVVTRWYRAPELLLNCSEYT
AAIDIWSVGCILGEIVTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRS
LPQYPKQQFRARFPTMSSGAMDLLERMLVFDPSKRITVDEALCHPYLASLHEIYDEPVCP
APFSFDFEQPSLTEEDIKEIIWREALKFNPEPIH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatggagggcggcggcggcggcggccatggccatcacggcggcggcggcggtggc
catggccatcacggtggcatcggaggaggggaggcgcagatcaaggggacgctgacgcac
ggcgggaggtacgtgcagtacaacgtgtatggtaacctgttcgaggtttcgtccaagtac
gtccctcccatccgccccgtcggccgcggcgcctgcggcatcatctgtgcggttgtgaat
gcgcagactcgtcaggaggtggcaatcaagaagatcggcaacgcgttcgacaaccagatc
gacgccaagcgcaccctgcgagagatcaagctgcttcggcacatggatcatgataatgtc
atctcaataaaggacatcatacggccaccaaggagggagaacttcaatgatgtctacatt
gtctatgagctcatggacactgatcttcaccaccttcttcgatcaaaccagccactaaca
gatgatcactgtcagtattttctctatcaggtactacgaggattgaagtatgtgcattca
gcaaatgtcttgcacagagacctcaggccaagtaatttgctgctgaatgcgaaatgcgat
cttaagatcggagactttggattagcaaggaccacaaatgaaactgacttcatgatggag
tatgttgttactcgatggtacagggcacctgaactcctgctaaactgctcagagtacact
gcagctattgatatctggtcggtaggctgcatccttggtgagatcgttacaagggagcct
ttgtttcctggaaaggattatgtccatcagctgaggctaataactgagttaataggctca
cctgatgactcgagccttgggtttcttcgaagcgacaacgcccgcagatatgtgaggtcg
cttcctcaataccccaagcaacaattccgtgcacggttccccactatgtctagtggtgcc
atggatttgcttgagaggatgcttgtgtttgatcccagcaaaaggattactgttgatgaa
gctctgtgccatccatacttggcatcccttcatgagatatatgatgaaccagtctgccca
gcgcctttcagcttcgatttcgagcagccgtcgctcaccgaagaagatatcaaggagatc
atatggagggaggcacttaagttcaaccctgaaccaattcactag

DBGET integrated database retrieval system