KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344737Help
Entry
4344737           CDS       T01015                                 

Definition
Os08g0163300
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:osa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:osa00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:osa03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:osa03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:osa03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:osa03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:osa03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 122 aa AA seqDB search
MRSGGDVRSFFRQQKAHAAGGVKPTGGVSKKAALPRHHHKPASQATPDRAVDDARRHVEE
AEEEEGRERMAREFDMDMRYGPCLGLTRAQRWRRAAALGLAPPPAVIAVCSDDQPCLWEG
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaggagcggcggcgacgtcaggtccttcttccggcagcagaaggcccacgccgccggc
ggcgtcaagcccaccggcggcgtctccaagaaggcggcgctgccccgccaccaccacaag
cccgcgtcgcaggcgacgccagatcgcgccgtcgacgacgcgaggaggcacgtcgaggag
gcggaggaggaggaggggcgggagaggatggctcgggagttcgacatggacatgcggtac
gggccctgcctcggcctcacccgcgcccagcgctggcgccgcgccgccgcgctcggcctc
gccccgccgcccgccgtcatcgccgtctgctccgacgaccagccgtgcctctgggagggc
cgcgtctag

DBGET integrated database retrieval system