KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344737Help
Entry
4344737           CDS       T01015                                 

Gene name
OJ9990_A01.115
Definition
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  
DNA polymerase delta subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    4344737 (OJ9990_A01.115)
   00240 Pyrimidine metabolism
    4344737 (OJ9990_A01.115)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    4344737 (OJ9990_A01.115)
   03410 Base excision repair
    4344737 (OJ9990_A01.115)
   03420 Nucleotide excision repair
    4344737 (OJ9990_A01.115)
   03430 Mismatch repair
    4344737 (OJ9990_A01.115)
   03440 Homologous recombination
    4344737 (OJ9990_A01.115)
DNA replication proteins [BR:osa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    4344737 (OJ9990_A01.115)
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      4344737 (OJ9990_A01.115)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     4344737 (OJ9990_A01.115)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 122 aa AA seqDB search
MRSGGDVRSFFRQQKAHAAGGVKPTGGVSKKAALPRHHHKPASQATPDRAVDDARRHVEE
AEEEEGRERMAREFDMDMRYGPCLGLTRAQRWRRAAALGLAPPPAVIAVCSDDQPCLWEG
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaggagcggcggcgacgtcaggtccttcttccggcagcagaaggcccacgccgccggc
ggcgtcaagcccaccggcggcgtctccaagaaggcggcgctgccccgccaccaccacaag
cccgcgtcgcaggcgacgccagatcgcgccgtcgacgacgcgaggaggcacgtcgaggag
gcggaggaggaggaggggcgggagaggatggctcgggagttcgacatggacatgcggtac
gggccctgcctcggcctcacccgcgcccagcgctggcgccgcgccgccgcgctcggcctc
gccccgccgcccgccgtcatcgccgtctgctccgacgaccagccgtgcctctgggagggc
cgcgtctag

DBGET integrated database retrieval system