KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344798Help
Entry
4344798           CDS       T01015                                 

Definition
(RefSeq) protein RAE1
  KO
K14298  mRNA export factor
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    4344798
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     4344798
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    4344798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 4344798
NCBI-ProteinID: XP_015651125
UniProt: Q6ZBS9
Position
8
AA seq 342 aa AA seqDB search
MATLGLAPNMNPNKSFEVLPNPGDSVSSLSFSPKSNLLVATSWDNQVRCWEIVGGSSQPK
ASISHDQPVLCSAWKDDGTTVFSGGCDKQVKMWPLLSGGQAQTVAMHDAPVKEIAWIPQM
NLLVSGSWDKTLRYWDTRQSNPVHVQQLPERCYALTVNYPLMIVGTADRNLVVFNLQNPQ
TEFKRIQSPLKYQTRCLAAFPDQQGFLVGSIEGRVGVHHIDDSQQSKNFTFKCHREGNDI
FSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAFSRCPLPIPCSTFNSDGSIFAYA
VCYDWSRGAENHNPATAKTSIYLHSPQESEVKGKPRIATSRK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcttggtcttgccccaaacatgaatccaaacaagtcatttgaggtactgcct
aatccaggtgactccgtatcgagcctcagttttagcccaaagagcaaccttctggtggca
acttcctgggataaccaggtgcggtgctgggagattgttggtgggagtagtcaaccaaag
gcatctatatcgcatgaccagccagtcctctgttcagcttggaaggatgatggaactact
gtgttctctggaggctgtgataaacaagtaaaaatgtggcctctgttgtctggtgggcag
gctcagactgttgcaatgcatgacgcacctgtcaaggagatcgcttggattcctcaaatg
aatcttcttgtctctggaagctgggataagactctaaggtattgggacacaaggcaatca
aatcctgtccatgttcagcaacttcctgagcgctgttacgcacttacagtgaattatccc
cttatgattgtgggaactgctgatcgtaatctggtcgtcttcaacttgcagaatcctcag
acggagttcaagcgcatccaatcgccactcaaataccagactaggtgtcttgctgcattc
ccggatcaacaaggatttttggtgggttccatagaaggaagagttggtgtgcatcatatt
gatgactcacagcaaagcaaaaatttcacgttcaaatgtcacagggaagggaatgatatt
ttctctgtcaattcactcaattttcacccagttcatcacacgtttgcaactgctggatca
gatggcgcatttaatttctgggataaggatagcaaacaaagactgaaggcttttagtcgg
tgccctcttcctattccttgcagtaccttcaacagtgatgggtcgatatttgcttatgca
gtctgctatgactggagccgtggggctgaaaaccacaaccctgccactgcaaagacatcc
atctatcttcacagtccacaggaatctgaggttaaagggaagccgagaatcgcaacaagt
agaaagtga

DBGET integrated database retrieval system