KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344798Help
Entry
4344798           CDS       T01015                                 

Definition
Os08g0176800
Orthology
K14298  
mRNA export factor
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    4344798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 342 aa AA seqDB search
MATLGLAPNMNPNKSFEVLPNPGDSVSSLSFSPKSNLLVATSWDNQVRCWEIVGGSSQPK
ASISHDQPVLCSAWKDDGTTVFSGGCDKQVKMWPLLSGGQAQTVAMHDAPVKEIAWIPQM
NLLVSGSWDKTLRYWDTRQSNPVHVQQLPERCYALTVNYPLMIVGTADRNLVVFNLQNPQ
TEFKRIQSPLKYQTRCLAAFPDQQGFLVGSIEGRVGVHHIDDSQQSKNFTFKCHREGNDI
FSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAFSRCPLPIPCSTFNSDGSIFAYA
VCYDWSRGAENHNPATAKTSIYLHSPQESEVKGKPRIATSRK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcttggtcttgccccaaacatgaatccaaacaagtcatttgaggtactgcct
aatccaggtgactccgtatcgagcctcagttttagcccaaagagcaaccttctggtggca
acttcctgggataaccaggtgcggtgctgggagattgttggtgggagtagtcaaccaaag
gcatctatatcgcatgaccagccagtcctctgttcagcttggaaggatgatggaactact
gtgttctctggaggctgtgataaacaagtaaaaatgtggcctctgttgtctggtgggcag
gctcagactgttgcaatgcatgacgcacctgtcaaggagatcgcttggattcctcaaatg
aatcttcttgtctctggaagctgggataagactctaaggtattgggacacaaggcaatca
aatcctgtccatgttcagcaacttcctgagcgctgttacgcacttacagtgaattatccc
cttatgattgtgggaactgctgatcgtaatctggtcgtcttcaacttgcagaatcctcag
acggagttcaagcgcatccaatcgccactcaaataccagactaggtgtcttgctgcattc
ccggatcaacaaggatttttggtgggttccatagaaggaagagttggtgtgcatcatatt
gatgactcacagcaaagcaaaaatttcacgttcaaatgtcacagggaagggaatgatatt
ttctctgtcaattcactcaattttcacccagttcatcacacgtttgcaactgctggatca
gatggcgcatttaatttctgggataaggatagcaaacaaagactgaaggcttttagtcgg
tgccctcttcctattccttgcagtaccttcaacagtgatgggtcgatatttgcttatgca
gtctgctatgactggagccgtggggctgaaaaccacaaccctgccactgcaaagacatcc
atctatcttcacagtccacaggaatctgaggttaaagggaagccgagaatcgcaacaagt
agaaagtga

DBGET integrated database retrieval system