KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345047Help
Entry
4345047           CDS       T01015                                 

Definition
Os08g0243500
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     4345047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 651 aa AA seqDB search
GRKRKREEAERSAAAVAGVGKGGKNASAAAGEEAGGADGRKRVTVFFGTQTGTAEGFAKA
LAEEAKSRYDKAIFKVVDLDEYAMEDEEYEERLKKEKISLFFVATYGDGEPTDNAARFYK
WFTEGNERGVWLNDFQYAIFGLGNRQYEHFNKVAKVVDELLVEQGGKRLVPVGLGDDDQC
IEDDFNAWKETLWPELDQLLRDENDVSTGTTYTAAIPEYRVEFVKPDEAAHLERNFSLAN
GYAVHDAQHPCRANVAVRRELHTPASDRSCTHLEFDIAGTGLTYETGDHVGVYTENCLEV
VEEAERLLGYSPEAFFTIHADKEDGTPLGGGSLAPPFPSPITVRNALARYADLLNSPKKS
ALVALATYASDSTEADRLRFLASPAGKDEYAQWVVASQRSLLEVMAEFPSAKPPLGVFFA
AVAPRLQPRYYSISSSPSMAPTRIHVTCALVHEKTPAGRVHKGVCSTWIKNAIPSEETKD
CSWAPVFVRQSNFKLPADPSVPVIMIGPGTGLAPFRGFLQERLSQKQSGAELGRSVFFFG
CRNSKMDFIYEDELNTFLEEGALSELVLAFSREGPTKEYVQHKMSQKASEIWDMISQGGY
IYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKSLQTEGRYLRDVW
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gggcggaagcggaagagggaggaggcagagaggtcggcggcggccgtggctggggtgggg
aagggcgggaagaatgcctccgcggcggccggggaggaggccggcggcgccgacgggagg
aagcgggtcaccgtcttcttcggcacgcagaccggcaccgccgagggcttcgccaaggca
ctcgctgaggaggctaagtcaagatacgacaaggcgatattcaaagttgtggacttggat
gagtatgcgatggaggatgaggagtacgaggagagattgaagaaggagaagatatcgttg
ttcttcgttgcaacgtacggagatggtgaaccgactgacaatgctgctaggttctataaa
tggttcactgagggaaatgagaggggtgtttggttgaatgacttccagtatgctattttt
ggtcttggcaatcggcagtatgagcatttcaacaaggttgccaaggttgttgatgagctc
ctagttgagcaaggtggaaaacgtcttgttccggttggtcttggagatgatgatcaatgc
attgaggatgacttcaacgcatggaaagaaactctctggccagaattggatcagttactt
cgggatgaaaatgatgtttcaacaggcactacctacacagctgccattcctgaataccgg
gttgaatttgttaagcctgatgaggcagcccatttggagagaaatttcagtcttgcaaac
ggttatgcggttcatgatgctcagcatccttgccgggccaacgtggctgtgcgacgggaa
ctccacactcctgcttctgatcgttcatgcactcacttggagtttgacattgctggcact
ggtcttacgtatgaaaccggtgaccatgttggtgtatacacagagaactgcctcgaggtt
gtagaggaggcagagaggttgttaggctactccccagaggcttttttcaccatccatgca
gacaaagaggacggtacaccactaggtggtggttctctggctcctccattcccttccccg
attactgtgaggaatgcgcttgctagatatgcggatcttctgaattcgccgaagaagagt
gctttggttgcattagctacttatgcttcagattctactgaagctgatcgtctgaggttc
ttggcctctcctgctggaaaggatgagtatgctcaatgggttgttgcgagtcaaagaagt
ctattagaagtgatggcagagttcccttcagcaaagcctccactaggagtcttctttgca
gccgttgctcctcgtcttcagccgagatactactcaatttcatcttcacctagcatggca
cctaccagaattcatgttacatgtgcacttgtccatgaaaaaacacctgctggaagggta
cataagggagtctgctcaacatggattaagaatgctattccatcagaagagacaaaggac
tgcagctgggctccagtttttgtgagacaatcaaacttcaaactgcctgctgatccttca
gtaccggttatcatgattggcccaggaactggtcttgctcctttccgcggattcttgcag
gagaggctgtctcaaaaacaatcaggagctgagcttggtcgctccgtattcttctttgga
tgcagaaacagcaagatggacttcatctatgaggatgagctgaacactttccttgaggaa
ggagcattgtccgagctggttctcgccttctctcgtgagggccctacgaaggaatacgtg
cagcacaaaatgtcgcagaaagcttccgaaatctgggacatgatctcccagggtggttac
atttacgtctgtggtgatgccaaaggcatggccagagatgtacatagagttctccacacc
attgtacaggaacagggatcacttgacagctctaaggctgagagctttgtgaagagcctc
caaacggagggtaggtatctgagagatgtgtggtaa

DBGET integrated database retrieval system